KEGG   Methylomicrobium alcaliphilum: MEALZ_0371Help
Entry
MEALZ_0371        CDS       T01649                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00230  Purine metabolism
mah01100  Metabolic pathways
Module
mah_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MEALZ_0371 (gmk)
Enzymes [BR:mah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MEALZ_0371 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 RsgA_GTPase MMR_HSR1 AAA_18 MobB AAA ABC_tran Zeta_toxin AAA_30 Urb2 NTPase_1 cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: CCE22071
UniProt: G4SXL6
Position
398909..399529
Genome map
AA seq 206 aa AA seqDB search
MTTGNLYIISAPSGAGKTSLVKQLTEELDKLTVSISHTTRQQRPGEVDGQDYFFVSVDEF
KTMLSEQAFLEHAQVFDNYYGTARRTVEESLNQGIDVILEIDWQGAQQIKKILPDCIAIF
ILPPSVSVLEQRLRNRGQDSEETIARRMRDAVTEMSHYGEYDYLIVNDVFERALNSLISI
VVSHRFHIDKQREALQSLLQELLSRE
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccggcaatctctatatcatttccgcaccttcaggggctggtaaaaccagtttg
gttaaacagttaacggaggagctcgacaaactgactgtttcgatttcccatacgacgagg
caacaacgtcccggagaagtcgacgggcaggattatttttttgtttcggtcgacgagttt
aagacaatgctttccgagcaggcatttcttgaacatgctcaggtgttcgataactattat
ggaaccgctcggcggaccgttgaggaaagtcttaatcaagggatcgatgtgatactcgaa
atcgattggcaaggggcgcaacaaattaaaaaaatactgccggattgtattgctattttt
attttacctccttcggttagcgtactggagcagcgcttgcgtaatcgaggacaggatagc
gaggaaacaattgctcggcgcatgcgcgatgcggtgacggaaatgagccattacggcgaa
tacgattatttgattgtcaatgatgtattcgaacgcgcactgaattcgttaataagtatc
gtcgtttcgcatcgttttcatatcgataaacaaagggaagcattgcagagtctgttacag
gagctattgagccgggagtaa

DBGET integrated database retrieval system