KEGG   Methylomicrobium alcaliphilum: MEALZ_1312
Entry
MEALZ_1312        CDS       T01649                                 

Gene name
erg
Definition
(GenBank) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00100  Steroid biosynthesis
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mah00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MEALZ_1312 (erg)
Enzymes [BR:mah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MEALZ_1312 (erg)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: CCE23001
UniProt: G4SW86
Structure
PDB: 
4QUV

Position
1467826..1469109
AA seq 427 aa
MSEQESRDNAAVDAVRQKYGFGFSWLVLMIALPPLVYYLWICVTYYQGELVFTSDAAAWR
RFWSHVAPPTWHAAGLYAAWFLGQAALQVWAPGPTVQGMKLPDGSRLDYRMNGIFSFLFT
LAVVFGLVTMGWLDATVLYDQLGPLLTVVNIFTFVFAGFLYFWGLNGKQWERPTGRPFYD
YFMGTALNPRIGSLDLKLFCEARPGMIFWLLMNLSMAAKQYELHGTVTVPMLLVVGFQSF
YLIDYFIHEEAVLTTWDIKHEKFGWMLCWGDLVWLPFTYTLQAQYLVHHTHDLPVWGIIA
IVALNLAGYAIFRGANIQKHHFRRDPNRIVWGKPAKYIKTKQGSLLLTSGWWGIARHMNY
FGDLMIALSWCLPAAFGSPIPYFHIVYFTILLLHREKRDDAMCLAKYGEDWLQYRKKVPW
RIVPKIY
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagtgaacaagaatcgagagacaatgcggccgtcgatgcggttcgtcagaaatacggt
ttcggcttttcatggcttgtgctcatgatagcgctgccgccactggtctattatttatgg
atttgcgtcacttattaccaaggtgaactggtcttcactagcgacgcggcggcttggcgg
cggttttggtctcatgttgcgccgccgacctggcatgccgcaggcctttacgcggcttgg
tttttaggtcaggccgcgttgcaggtttgggcgcctggtccgaccgttcaaggcatgaaa
ttgcctgacggcagtcggctcgattatcggatgaatggaatattttctttcctttttacc
ctggccgtggtgttcggtttggtaacgatggggtggttggacgctaccgttttgtatgac
caactcggcccattgcttactgtagtgaatatttttacctttgtttttgcgggttttctc
tatttttggggcttaaacgggaagcaatgggagcggccgaccggacgtcctttttatgat
tatttcatgggaacggcgcttaacccacggattggatctcttgatctcaagctgttttgc
gaagcccgccccggcatgattttttggttactgatgaatctttcgatggcggccaaacag
tatgaattgcacggcacggtgactgtcccgatgttgctcgtggtggggtttcaaagtttt
tatttgatcgattactttatccatgaagaagccgtcctgacgacttgggatatcaagcac
gagaagtttggctggatgctttgttggggagacttggtgtggttgccttttacctatacc
ttgcaggctcagtatttggtccatcatacccatgacctgcccgtatggggcattattgct
attgtggctttgaatttggccggttatgcaatttttcggggcgccaatatccaaaagcat
cattttcggcgcgatccaaaccggattgtgtgggggaagccggcaaaatatattaaaacc
aagcaaggttcattattactgacttccggttggtggggcattgctcgtcacatgaattac
ttcggcgatttgatgattgcactctcgtggtgtttgcccgctgctttcggtagccccata
ccttatttccatatcgtatatttcaccattttgcttctgcatagagaaaagcgcgatgat
gcgatgtgcttggcaaagtacggcgaagattggttgcaataccggaaaaaggtgccttgg
cgtatcgtgccaaaaatttactaa

DBGET integrated database retrieval system