KEGG   Methylomicrobium alcaliphilum: MEALZ_1811Help
Entry
MEALZ_1811        CDS       T01649                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase (TIM) (Triose-phosphate isomerase)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00010  Glycolysis / Gluconeogenesis
mah00051  Fructose and mannose metabolism
mah00562  Inositol phosphate metabolism
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01120  Microbial metabolism in diverse environments
mah01130  Biosynthesis of antibiotics
mah01200  Carbon metabolism
mah01230  Biosynthesis of amino acids
Module
mah_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_1811 (tpiA)
   00051 Fructose and mannose metabolism
    MEALZ_1811 (tpiA)
   00562 Inositol phosphate metabolism
    MEALZ_1811 (tpiA)
Enzymes [BR:mah01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MEALZ_1811 (tpiA)
Exosome [BR:mah04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MEALZ_1811 (tpiA)
  Exosomal proteins of bladder cancer cells
   MEALZ_1811 (tpiA)
  Exosomal proteins of melanoma cells
   MEALZ_1811 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCE23497
UniProt: G4T1R5
Position
2084023..2084772
Genome map
AA seq 249 aa AA seqDB search
MRQTLVAGNWKMNGSKAATESLCKAIIAGLNSSDTGIVVCVPYVYLSDAAKLTEGTPLDL
GAQNVADQSSGAYTGEISASMLNEFNCKYAIVGHSERRTYYGDTNESVASRYSQAQQQGI
VPILCVGETLEQRENDQTFSVIDEQLDAVLNAAGIESFAKAVVAYEPVWAIGTGRTASDE
QAQEVHQYIRQKFAAKNQAIADQLQILYGGSVKPDNAKGLFAMPDIDGGLIGGASLDAEG
FLKIYSASK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaacactcgtggctggaaactggaaaatgaatggctctaaagcggccacagaa
tcgttatgcaaggccattattgccggacttaactcatccgacaccggaatcgtagtgtgt
gttccttatgtttatttatccgatgcagctaaattaacggaaggcacccctcttgatctt
ggcgcacaaaatgttgccgatcaaagttctggcgcatataccggagaaatctcagcgtcc
atgctgaacgaatttaattgcaaatatgcaatcgtcggtcactccgaacgtaggacttat
tacggcgacaccaacgaatcggttgcttcacgttattctcaagcccaacaacaaggaatc
gttcctatattgtgcgttggcgaaacattagagcaacgtgaaaacgatcaaacgtttagc
gtcatcgatgagcagctcgatgcggttttaaatgcggcagggatcgaatctttcgctaaa
gcagttgttgcttatgagccggtatgggccatcggtacaggaagaaccgcctctgacgag
caggcacaagaagttcatcagtatattcgccaaaagttcgcagctaaaaatcaagcgatt
gccgaccaactgcaaattttgtatggcggcagtgtaaagccggacaatgctaaaggctta
tttgcaatgcctgatatcgacggcggattaatcggcggagcatcactcgatgccgaaggc
tttttgaaaatatatagcgcatctaaataa

DBGET integrated database retrieval system