KEGG   Methylomicrobium alcaliphilum: MEALZ_1926
Entry
MEALZ_1926        CDS       T01649                                 

Definition
(GenBank) Type VI secretion protein, VC_A0114 family
  KO
K11893  type VI secretion system protein ImpJ
Organism
mah  Methylomicrobium alcaliphilum
Brite
KEGG Orthology (KO) [BR:mah00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mah02044]
    MEALZ_1926
Secretion system [BR:mah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MEALZ_1926
SSDB
Motif
Pfam: T6SS_VasE
Other DBs
NCBI-ProteinID: CCE23612
UniProt: G4T2V9
Position
2214107..2215444
AA seq 445 aa
MAENNRTVWSEGMFLRPQHFQQHDRYIETFVKERCGNLTPYDWGVKKIAIDQRQLAMGKF
ALAECSGIFPDGTPFNLPEDDDLPLPVDIPTDVQNNIVYLSLPVRQPGTIEIDTDENRHN
LARYHAFESEVRDHNTGSNATSAILVGKLHTRLLLERQERSGHVCIGVARVIESRVDKNV
ILDQGFIPPSLDCNAVPILNGFIKELFGLLHTRGEALGGRASEAGRGGVAEISDYMLLQM
VNRVEPLFEHLQSIPALHPESFYRIAVQLAGELSTFCRPNKRPVSFPVYRHDDLQTTFMH
VMEELRQLLSAVLEQNAIPIPLTAPKYGIRGAKVPDPNLLKDAVFVLAANAQVSKEQLRS
GFPTQVKIGPVEQIQQLVRSALPGISIHALPVAPRQIPYHAGFAYFELNKQSELWKQMAQ
SGGFAIHIAGEFPGLELEFWAIKNG
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggcggaaaataacaggacggtttggtcggaaggcatgtttttgcggccccagcatttt
caacaacacgaccggtatatcgaaaccttcgtcaaggaacgatgcggcaaccttacgcca
tatgattggggcgtcaaaaaaattgccatagaccagcggcagcttgccatgggcaaattc
gccttggctgaatgcagcgggatttttccggacggaacgccgtttaatttgcctgaagac
gacgacttgcctttacccgtcgatattcctaccgacgtacaaaacaatatcgtttacctg
tcgctaccggttcgccaaccgggtacgattgaaatcgataccgacgagaaccgccataat
ctggcgcgctatcatgccttcgaaagcgaagttcgcgaccataataccggatcgaatgca
acctctgcgatcttggtcggcaagctgcatactaggttgttattggagcggcaagagcgc
tccggtcatgtttgtatcggggtggccagagtcatcgagtcgagggtcgataaaaacgtg
attctcgatcagggttttattccgccttcgctcgattgcaatgccgtgccgatcttgaac
gggtttatcaaagagctgttcggcttattgcacacccgcggagaagcgctcggcggccgg
gcttccgaagcgggccgggggggagttgccgaaatttccgattacatgctgctgcaaatg
gtcaatcgtgttgagccattgtttgaacatttgcaatccattcccgcattgcatccggaa
agtttttaccgaattgcggtgcaattggccggcgagttatcgacattttgcaggcccaat
aaaagaccggtgagttttccggtttatcggcacgacgatttacaaacgacctttatgcat
gttatggaggagttgcggcaattattgagcgcggtattggagcaaaacgcgattccgatt
ccgttgacagcaccgaagtacggtattcgcggcgcgaaggtgccggacccgaatttgctc
aaggatgccgtattcgtgctggccgcgaatgcgcaagtatcgaaggaacaattgcgcagc
ggttttccgacgcaagtcaaaatcggtccggtcgaacagattcagcaattggtgcgttcg
gccttgcccggtatttcgattcatgcgctgccggtcgcgccccggcagattccttatcat
gcgggtttcgcttatttcgagcttaacaaacaaagcgagctatggaagcaaatggctcaa
tcgggcggttttgctatccatatcgccggtgagtttcctgggcttgaacttgaattttgg
gcaatcaaaaacggttaa

DBGET integrated database retrieval system