KEGG   Methylomicrobium alcaliphilum: MEALZ_1928Help
Entry
MEALZ_1928        CDS       T01649                                 

Definition
(GenBank) conserved membrane protein of unknown function
  KO
K11891  type VI secretion system protein ImpL
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mah00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    MEALZ_1928
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mah02044]
    MEALZ_1928
Secretion system [BR:mah02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   MEALZ_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: CCE23614
UniProt: G4T2W1
Position
2216808..2220371
Genome map
AA seq 1187 aa AA seqDB search
MKKIIGFFKNKWVIQLIGIIAVGLLIWFFGPLIAIAGSVPLESEVSRLITILVIVLLWGL
NNLRIQVKANRANTQMVNELVGGAQGTTGPSQVEQDSEEEIGELGKHFDDALRTLKQIKT
QSGQGRQYLYELPWYIIIGPPGSGKTTALINSGLEFPLADKFGKNAVKGVGGTRNCDWWF
TDQAVLLDTAGRYTTQDSHEAVDKAAWLGFLNLLKKHRPRRPVNGVLITMSLSDLIKQTE
EERIQHAQAIRQRIQELHEHFGIRFPIYMLFTKCDLIAGFNDFFADLGKEERAQVWGVTF
PEEDQDHPIDAVGRVGDDFDGLLDRLNARLPKRLQEERDLQRRHSIFGFPQRMALLKESL
LEFLKECYGANRYQQAPYLRGVYFTSGTQEGTPIDRLMGILASTFKLDRFLVPMFSGKGK
SFFITRLLKDVIFDEALIVGLNKRVERRYALLRQVAYGSALAVTLLMAALWTFSFTRNQS
ALNELSQKIEQYEQTAANYPNRSDFADLLKRMNAMQDIQRVYGDEKPLSMRFGLFQGNKV
QPVINDTYDQVLLKQFLPLIKTRLEQRIRGEEANNPEILYELLKVYLMFGEPKRLEPGLV
RPWIAIDWKKNYADDVQVGLLGHLDNLLELKIEPQLLDQRLVAATRQVLNRIPVAQQVYM
RIKSEAMQDGSRDLRLSDALGPNASRVFTVASGKFEQQTIPYLFTHDGFYQVFLKQNQAL
AKETVEDNWVLGDVGRARAPDPERLQQDVQTYYDKDFIQYWSDMLGNLKIRSVGNIQQSI
ELLEFASAPNSPIRLLLETIDKETSLTRKPPSPLDALAAVKEGAEKTVDSRTQKLLQAAQ
AEGVVQAPTDPPGTVVERHFQPLASLVRSVGGAGAPFDQTINLLGQLYGFMIDLGSTSDS
GGAAIRIAAQRSEGGGGGDVMSRMKMESARLPEPLKSMTEKLSSGNLNLIMGSSKAQLNK
LWQSEVMPLYKSGLEGRYPLSRRATREITLQDFSRFFAPNGILDQFFNANLKPFVDTSGR
TWRLITQNNQSIGISRSVLMQFQYAAKIREVFFQGGSQLPSVRFNLRPVSLDAKASRFWL
NLEGQQLDYRHGPARSTQLQWPGTDGSGSVRYGFDTLDGRQVSRSEEGAWAWFKLLDKAR
IQITAQDRFMLTFAIDNLEARYELSATSVDNPFALKELQNFQFPTSL
NT seq 3564 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaatcatcggtttcttcaaaaataaatgggtcattcaactgatcggtattatt
gccgtcggcctgttaatttggtttttcgggccgctcattgcgatagcaggaagtgtcccc
cttgagtccgaagtttccaggctaattacgattctagtgatcgtcttgctctggggattg
aataatctacgcattcaggtcaaagccaatcgtgccaatacgcaaatggtcaatgagctg
gtcggaggcgcccaaggaacgaccgggcccagtcaagtcgagcaagatagcgaggaggaa
atcggcgaactcggcaagcatttcgacgatgcgctacgcacgctaaaacaaatcaaaact
cagtcgggccagggtcgtcaatatctctatgaattaccctggtatatcatcatcgggccg
ccgggctccggaaaaaccaccgcattgatcaattcgggactggagtttccgctggccgac
aaattcggcaaaaacgcggtcaaaggcgtcggcgggacccgcaattgcgattggtggttt
accgatcaagcggtgctgttggataccgctggacgctatacgacgcaagacagtcacgag
gcagtcgataaggcggcatggctcggttttttaaatttgctgaaaaaacatcggccgcgc
agaccggtcaacggcgtgctgatcacgatgagcctgtccgatttgatcaagcagaccgag
gaggagcgaattcaacatgcgcaagcgattcggcagcgtattcaggagttgcacgaacat
ttcggcattcgctttccgatctatatgctgtttaccaaatgcgatctgattgcaggtttc
aacgacttctttgccgatctaggcaaagaagaaagagcccaagtttggggtgttactttt
cctgaagaagatcaagatcaccctatcgatgctgttggtcgggtcggcgatgattttgat
ggcctgctggatcgtttgaatgcgcgtttgccgaaaagacttcaagaagagcgcgacttg
cagcgccgtcattcgattttcggctttccgcaacgcatggctttgctgaaagagagtttg
ttggagtttctcaaagagtgttacggcgcgaaccgatatcaacaagccccttatctcaga
ggcgtttattttaccagcgggacgcaagaaggcacgccgatcgaccgtctgatggggatt
ttggcgagtactttcaaactcgatcgttttttggtgccgatgttcagtggcaagggaaag
agttttttcattacccgtttgctgaaagatgtcattttcgacgaagcgctgatcgtcggt
ttgaacaaacgcgtagagcgtcgttatgccttgcttcgtcaggttgcatacggttcggca
ctggctgtgacattattaatggcggccttatggacttttagttttactcgaaatcagtcg
gcattgaacgagctgagtcaaaagattgaacaatacgaacaaaccgcggcgaattatccg
aatcgatcggactttgccgacttattgaaacgcatgaatgcgatgcaagacattcaacga
gtttatggcgacgaaaagcccttgtcgatgcgtttcggcttgtttcaaggcaacaaagtg
caaccggtcattaacgatacttatgatcaagttttattgaagcaatttttaccattgatc
aagacaaggctagaacaacgtatccgaggcgaagaggcgaataaccccgaaattctctat
gaactcttaaaagtatatttgatgttcggcgagcccaaacggctcgagccaggcttagtg
cggccttggattgctatcgattggaaaaaaaattatgccgacgatgttcaagtcggcttg
ctcggccatctcgataatttgctcgagctaaaaatagagccccagctgctcgaccaacgg
ttagtcgccgcaacgcggcaagtgttaaaccgcattcctgttgcgcagcaagtctatatg
cgcatcaagagcgaggcgatgcaggatggcagccgcgatctccgtttgtcggatgcgcta
gggcctaatgcgtctcgggtttttacggtcgcgtccggaaaattcgaacagcaaaccatt
ccttatttgttcacacacgacggtttttatcaagtatttctaaaacaaaaccaagctttg
gcgaaagagacggtcgaggataattgggtgttgggcgatgtcggtagagcccgcgcgccc
gatcccgaacgcttgcagcaagacgttcagacctattacgacaaggatttcattcagtat
tggagcgatatgcttggcaatctaaaaatcagaagcgtcggtaatattcaacaatcgatc
gaattactcgaattcgcttcggcgcccaactcgccgattcgactattattggagactatc
gacaaggaaacttccctaacacgcaaaccgccaagtcctttggatgctttggcggcggtc
aaggaaggcgcggaaaaaacagtagattcgcgcacgcaaaaactgttgcaagccgcacaa
gccgaaggtgtcgtgcaagcaccgaccgatccgccgggcacagtcgtcgagcgccatttt
caaccgctagcttcattggtaaggagcgtcggcggcgcaggcgcgccattcgatcagacc
atcaatctgctcggtcaattgtacggttttatgatcgatttgggcagtacttcagatagc
ggcggcgcggcaataaggatcgccgctcagcgcagcgaagggggcggcggaggcgatgtc
atgtcgcgcatgaaaatggaatcggcgcgtttgccagaaccgttaaaaagcatgaccgaa
aaactgtccagcggcaatttgaatctgatcatggggtcgagcaaggcgcagctcaataag
ctttggcagagcgaggtcatgccgctttataaatcgggactcgaaggccgttatccgctg
tccagacgcgccactcgagaaattactttgcaagattttagccggttttttgcaccgaac
ggtatcctggatcagtttttcaatgccaatctcaaaccttttgtcgataccagcggccga
acctggcgattgatcactcaaaataatcaatcgatcggtatttcgcgatcagtgctgatg
cagtttcaatatgcggcaaaaatccgtgaagtattttttcaaggcggtagtcaattaccc
tcggttcgattcaatcttagaccggtatcgcttgatgccaaagcttcacggttttggctg
aatttggaaggtcagcaattggattaccggcatggtccggcgcgaagtacgcaactgcag
tggcctggaacggacggaagcggttctgtgcgttacggtttcgataccttagacggccgt
caagtcagccgttccgaggagggcgcttgggcatggtttaagctgcttgataaagcccga
attcaaattaccgcgcaagacaggttcatgctgacattcgcaatcgacaacttggaagcg
cgttatgaattgagcgcgaccagcgtcgataatccttttgcgctcaaagaactgcaaaat
tttcaatttccaacgagcttgtaa

DBGET integrated database retrieval system