KEGG   Methylomicrobium alcaliphilum: MEALZ_2502Help
Entry
MEALZ_2502        CDS       T01649                                 

Gene name
hemN
Definition
(GenBank) Oxygen-independent coproporphyrinogen III oxidase (Coproporphyrinogenase) (Coprogen oxidase)
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00860  Porphyrin and chlorophyll metabolism
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mah00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MEALZ_2502 (hemN)
Enzymes [BR:mah01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     MEALZ_2502 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: CCE24180
UniProt: G4SWG7
Position
complement(2873993..2875369)
Genome map
AA seq 458 aa AA seqDB search
MDQSLTFDLDLIHRYDQAGPRYTSYPTALELHENFGEADYLRHIEQSNRLGGPLSLYFHI
PFCDTVCYYCACNKIVTKNRAHAEPYLNDLCREIEMQGALFDRGRVVDQLHWGGGTPTFL
SESQMRRLMVSTRRHFNLREDDEGQYSIEVDPRETDDRTIAVLRELGFNRISLGLQDFEP
DVQKAVNRIQTEQETFAVLEAARNEGFRSTSIDLIYGLPLQTVESFSRTLEKILQVSPER
FSVFNYAHLPQRFKTQRQIDDADIPVPEVKLAILQMVIQRLTEAGYVYIGMDHFAKPNDE
LAVAQREGKLYRNFQGYSTHSECDLIGLGITSIGRVGDAYIQNVKNLDTYRQTIEQGRLP
VFKGFELSWDDKLRRAVISGLICHFELKFRELEREFSIDFKTYFEQELIELQKMAEDGLL
TIDTDQILVRPAGRLLIRNICMVFDRYLTEKQQFSKVI
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtccttaacgttcgatctcgatctcatccatcgttacgatcaggccgggcct
cgatatacgtcttatccgactgcgttggaattacacgagaatttcggcgaagcggattat
ttacgtcatatcgagcaatcgaataggcttggagggccgttatcgctttattttcacatt
ccgttttgcgatacggtctgttactactgcgcgtgcaataagatcgtgaccaaaaatcgc
gcgcatgccgagccgtatttgaacgatctttgtcgcgaaatcgaaatgcagggcgctttg
ttcgatcgaggccgtgtcgtcgatcaattgcattggggaggcggaacgccgactttctta
agtgagagccaaatgcggcggctgatggtgtcgactcgtcggcatttcaatctgcgcgag
gatgacgaaggacagtactcgatcgaagtcgatcctagagaaaccgacgatcggacaata
gccgtgctgcgggaattgggttttaaccggattagcttgggtttgcaggattttgaaccc
gatgtgcaaaaagcggtcaatcgcattcaaaccgaacaggaaacttttgcggtattggag
gcggcgcgcaacgaaggttttcgttcgaccagtatcgatttgatttacggattgccgcta
cagaccgtcgagtcgttttcgcgaacattggaaaagatccttcaggtctctcccgagcgg
ttttcggtctttaattatgcgcatttgccgcaacgcttcaaaactcagcgccagatcgat
gatgccgacataccggttccggaagtcaagttggcgattttgcaaatggtgattcagcgc
ttgaccgaagccggttatgtttatatcggcatggatcatttcgcaaaaccgaatgacgaa
ttggcggttgctcagcgcgaagggaagctgtaccgaaattttcagggctattcgacacac
tccgaatgcgatttgattggcttggggattacttcaatcggtcgagtgggcgatgcctac
attcaaaatgtaaaaaatcttgacacttatcggcaaacgatagagcagggacgtttgccg
gtgttcaaagggtttgaattgagctgggacgataagctaaggcgagcggtcatcagcggg
ttaatctgtcacttcgagcttaaattcagagagctcgagcgcgagttctcaatcgatttc
aagacatacttcgagcaggaattgattgagttgcagaaaatggccgaagacggacttttg
acgatcgataccgaccaaattttagtgcgaccggctgggcgtttgctgatccgtaatatc
tgtatggtatttgatcgttatcttactgaaaagcaacagttttccaaagttatttaa

DBGET integrated database retrieval system