KEGG   Methylomicrobium alcaliphilum: MEALZ_2864Help
Entry
MEALZ_2864        CDS       T01649                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00010  Glycolysis / Gluconeogenesis
mah00620  Pyruvate metabolism
mah00640  Propanoate metabolism
mah00680  Methane metabolism
mah01100  Metabolic pathways
mah01110  Biosynthesis of secondary metabolites
mah01120  Microbial metabolism in diverse environments
mah01130  Biosynthesis of antibiotics
mah01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MEALZ_2864 (acsA)
   00620 Pyruvate metabolism
    MEALZ_2864 (acsA)
   00640 Propanoate metabolism
    MEALZ_2864 (acsA)
  Energy metabolism
   00680 Methane metabolism
    MEALZ_2864 (acsA)
Enzymes [BR:mah01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MEALZ_2864 (acsA)
Lipid biosynthesis proteins [BR:mah01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MEALZ_2864 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CCE24530
UniProt: G4T0D8
Position
3283686..3285623
Genome map
AA seq 645 aa AA seqDB search
MTEVKTYPVDPELSARAHITPERYKTLYRQSIDEPESFWAEQAEQFLDWFKPWDKVMDYD
YSKGYIRWFEGGELNVSYNCLDRHLATRGDQTAIIWESDDPAQDKKVSYRELHREVCKFA
NVLKSQGVKKGDRVCIYLPMIVEAAVATLACARIGAVHSIVFGGFSADSLRDRIQDADCH
TVICADEGLRGGKKIPLKTSVDQAISHCPNVKTVIVIKNTGNDIPWTPKRDIWYHEAMKT
ASDNCPPETLSAEDPLFILYTSGSTGKPKGLLHTTGGYLLFAAMTHKYVFDYHDGDIYWC
TADIGWVTGHSYIIYGPLCNGATTLMFEGIPTYPEPDRFWRIVDKHQVNIFYTAPTAIRA
LMAQGNDFVNRTDRSSLRILGTVGEPINPEAWEWYYHIVGNERCPIMDTWWQTETGGILI
TPLPGAIALKPGSATLPFFGVKPEILDNAGNVLEGEAEGVLVLSRPWPGQARSIYGDHNR
FIDTYFKNFPGYYFAGDGARRDRDGYYWITGRVDDVINVSGHRMGTAEVESALVLHEDVA
EAAVVGYPHPIKGQGIYAYVTLNSGVHASEALKQELVDLVRKEIGAIAHPDIIQWAPGLP
KTRSGKIMRRILRKVASNEIDSLGDTSTLADPSVVDEIIDHRANK
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtgaaaacctatcctgtcgatcccgaactgtcagcccgagctcacattaca
ccggaacgctataaaacactttatcgacaatcgatcgatgaaccggaatccttttgggcc
gaacaagccgaacaatttctcgactggttcaagccttgggataaagtcatggattacgac
tattcgaaaggctacatccgctggttcgaaggcggcgaactcaatgtcagctacaattgc
ttggaccggcatttagccacacgaggcgaccaaactgcgattatctgggaaagcgacgat
cccgctcaagacaaaaaagtcagttaccgtgaattgcaccgagaagtttgcaaattcgcc
aatgttctaaaaagccaaggcgtcaaaaaaggcgaccgagtctgtatttacctgccgatg
atcgtcgaagcggccgtcgccaccctggcctgtgcccgaatcggcgcagtccactccatc
gtgttcggcggtttttcggccgactctttacgcgaccgcatacaagacgccgactgccac
actgttatctgcgccgatgaagggcttcgcggcggcaaaaagataccgctcaaaaccagt
gtcgaccaggcgatttcacactgcccgaatgtcaaaactgtcatcgtcatcaaaaacacc
ggaaatgatattccgtggacgccgaaacgcgatatttggtatcacgaagcgatgaaaacc
gcatcggacaactgcccgcccgagaccctatccgccgaagacccgttattcattctttac
acatcgggttctaccggtaaaccgaagggcctgctgcacaccacgggcggatatttatta
ttcgccgcgatgacgcataaatatgtattcgattatcacgacggcgatatttattggtgc
accgccgatatcggctgggtcaccggccattcttacatcatttacggaccgctctgcaac
ggcgcaacgactttgatgttcgaaggtattccgacctaccccgagcccgaccgattttgg
cgcatcgtcgataaacaccaagtcaatattttttataccgcgccaactgcaattcgcgcc
ttgatggcgcaaggcaacgactttgtcaatcgcaccgaccgcagcagtttaagaatcctc
ggcacggtcggcgaaccgatcaaccccgaagcgtgggaatggtattatcacatcgtcggc
aacgaacgctgccctatcatggatacttggtggcaaaccgaaaccgggggcattttgatc
acgccgctgcccggcgccatagcattgaaaccgggctcggcgacactgccgttcttcggc
gttaaaccggaaattctcgacaatgccggtaatgtactcgaaggcgaagctgagggggtt
ctagtattgagccgcccgtggccgggtcaggccagaagtatttacggcgatcacaaccgt
tttatcgacacctattttaaaaattttccgggctattattttgccggcgacggcgctcgc
cgcgacagggacggttattactggatcaccggccgcgtcgatgatgtaatcaatgtttcg
ggccatcgcatggggaccgcagaagtcgaaagtgcgctggtcttgcatgaagacgtcgcc
gaagccgccgtggtgggctacccgcatcctatcaagggccagggcatttatgcttatgtc
acgctcaattccggcgttcacgcaagcgaagctctcaagcaggaattggtcgatctggtt
agaaaagaaatcggagccatcgcccaccccgatatcattcaatgggcaccgggccttccg
aaaacgcgctcaggaaaaatcatgcggcgtattttaagaaaagtcgcctcgaacgaaatc
gacagcctaggcgatacctccacgctggcagacccatcggttgtagatgaaatcatcgat
catagagccaataaataa

DBGET integrated database retrieval system