KEGG   Methylomicrobium alcaliphilum: MEALZ_3518Help
Entry
MEALZ_3518        CDS       T01649                                 

Gene name
nagZ
Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00520  Amino sugar and nucleotide sugar metabolism
mah01100  Metabolic pathways
mah01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MEALZ_3518 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MEALZ_3518 (nagZ)
Enzymes [BR:mah01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MEALZ_3518 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 PA DUF2586
Motif
Other DBs
NCBI-ProteinID: CCE25180
UniProt: G4SVU5
Position
4056551..4057570
Genome map
AA seq 339 aa AA seqDB search
MTTNSAIGPIMIDVEGLTLTTHEQEKIHHPNTGAVILFSRNYESPEQLIALIDSIRNARK
GPILIAVDQEGGRVQRFKQGFTRLPPANCYRERPELAEAAGWLMASEMLSVGIDFSFAPV
LDVDCGISEVIGDRSFSTDPQLTAQLAASFRKGMRSAGMSATGKHFPGHGAVAADSHIAL
PVDERELSEIRTKDLVPFKLLIEQGLEAVMPAHVVYPAVDDMPAGFSQKWLQNILRRELY
FNGAIFSDDLNMEGAAIAGDFSERAKLAQQAGCDMLLVCNNPKAAEQVLDSVPIKTDPLR
TQRLDAMRGIPKMTRAMLQASNQWQQISQQIAQISNEYA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaccactaattccgcaatcggccccatcatgatcgatgttgaaggcttgactttaacc
actcatgaacaagaaaagatccatcaccccaacaccggcgcggtgattcttttttcccgc
aattacgaatcacccgaacaacttatcgctttgatcgacagcattcgcaacgcccgaaaa
ggccctatactcatcgccgtcgaccaggaaggcgggcgtgtacaacgattcaagcaaggc
tttacgcgcttaccgccggccaattgttatcgtgaacggcccgagctcgccgaagctgca
ggttggctaatggcgtcagagatgctgtccgtcggcattgattttagcttcgctcccgta
cttgatgtcgattgcggcatcagcgaagtcatcggcgaccgatcattctcgaccgaccct
caactgacagctcaattggcagccagctttcgcaaaggcatgcgatcggccggcatgtct
gcaaccggcaagcatttccctgggcacggcgcggtagctgccgattcgcatatagcatta
ccggtagacgaacgggaattaagcgaaatccgaactaaggacttagtcccatttaaatta
ttgatcgaacaaggcttggaagcagtcatgcccgcgcatgtcgtctaccctgctgtcgac
gacatgccggctggattctcccaaaaatggctgcaaaacattttacggcgtgaactttat
tttaacggcgccatatttagcgacgacctaaatatggaaggcgcagcaattgccggcgat
ttttccgaacgtgcgaaactagcccaacaagccggttgcgatatgctgttagtttgcaat
aatcccaaagcggccgaacaagtactcgacagcgtaccgatcaaaaccgatccgctaaga
acacaacggcttgatgcgatgcgcggaatacccaaaatgacccgagcaatgctccaagca
tctaaccaatggcaacaaatatcacaacaaatcgctcaaatttccaatgaatatgcttga

DBGET integrated database retrieval system