KEGG   Methylomicrobium alcaliphilum: MEALZ_3586Help
Entry
MEALZ_3586        CDS       T01649                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase (Gamma-glutamyl kinase) (GK)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mah  Methylomicrobium alcaliphilum
Pathway
mah00330  Arginine and proline metabolism
mah00332  Carbapenem biosynthesis
mah01100  Metabolic pathways
mah01130  Biosynthesis of antibiotics
mah01230  Biosynthesis of amino acids
Module
mah_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mah00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MEALZ_3586 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MEALZ_3586 (proB)
Enzymes [BR:mah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MEALZ_3586 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCE25244
UniProt: G4SWL8
Position
complement(4142674..4143795)
Genome map
AA seq 373 aa AA seqDB search
MSRSDFAKTKRVVVKIGSSLLTAGGRGLNKEAIAAWVAQMASLRARGIEVILVSSGAVAE
GMARLGLKVRPKTLHELQAAASVGQMGLVRVFENNFQQHGLHAAQVLLTHDDLSDRRRYL
NARSTLLALLKFGVVPVINENDAVATEEIRFGDNDTLGALVANLIEAELLVILTDQQGLF
TADPSIDPAARLVSEINVNDASLDIMAGDSRSGLGRGGMYTKVRAARLASRSGAATVIAA
GVAENVIAEIVAGKPIGTYMVPSIGPLLARKRWLAGQLQVKGRLELDDGAVKVLRDAGKS
LLAVGVKNVIGGFQRGELVSCVSAQGMEVARGLINYSAEDVRKVVGRPSSEFECILGYAD
DEELIHRDNMVVM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagaagtgattttgctaaaacgaaaagggtagtagtcaagatcggtagttcttta
ttgaccgccggcggacgaggtctcaataaggaggcaattgcggcttgggtcgcgcaaatg
gcaagtttgcgtgcgcgcggtatcgaagtgatcttagtttcttcaggggcggtagccgag
ggtatggctcgtttaggtttgaaggttcgtccgaaaacattgcatgaattgcaggctgcg
gcttcggtggggcaaatggggttggttcgtgtttttgaaaataattttcagcaacacgga
ttgcatgccgcgcaggttttgttgacgcatgatgacttgtcggatcggcggcgctattta
aatgcgaggagcacgttgttggcgctgctcaaattcggtgtcgtgccggttattaatgag
aacgatgcggtggcgaccgaagaaattcgtttcggcgataacgatacattgggtgctttg
gtggcgaatctgattgaagccgagttgttggttattttgaccgatcagcaggggttgttt
actgcagatccgagcattgatccggctgcgcgtttggtttcggaaatcaatgtgaatgat
gccagtctcgatattatggcaggagatagtcgtagcgggcttggtcgaggagggatgtat
accaaggtgcgagcggcaagattggcttcgcgttccggcgccgccaccgtgattgcggcc
ggtgttgcagagaatgtgattgctgaaatcgtggcgggtaagccaattggtacctatatg
gtgccgagtattgggccgttattggcgagaaagcgttggttggccgggcagttgcaggtt
aagggtcgcctggaattggatgatggtgcggtgaaagttttaagggatgctggcaaaagc
ttgttggcggtgggggtaaaaaacgtaatcggcgggtttcagcgcggcgaattggtttct
tgcgtgagtgcgcaagggatggaggttgcgcgaggcttaattaattatagtgcggaagat
gtgagaaaagttgtcggaagaccgagttcggaattcgagtgtattctcgggtatgcggac
gatgaggaattaattcatcgtgacaatatggttgtcatgtag

DBGET integrated database retrieval system