KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1315Help
Entry
MICA_1315         CDS       T01630                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00010  Glycolysis / Gluconeogenesis
mai00051  Fructose and mannose metabolism
mai00562  Inositol phosphate metabolism
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
mai01230  Biosynthesis of amino acids
Module
mai_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_1315 (tpiA)
   00051 Fructose and mannose metabolism
    MICA_1315 (tpiA)
   00562 Inositol phosphate metabolism
    MICA_1315 (tpiA)
Enzymes [BR:mai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MICA_1315 (tpiA)
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MICA_1315 (tpiA)
  Exosomal proteins of bladder cancer cells
   MICA_1315 (tpiA)
  Exosomal proteins of melanoma cells
   MICA_1315 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP09637
UniProt: G2KSN7
Position
complement(1307937..1308704)
Genome map
AA seq 255 aa AA seqDB search
MTTKKKLIAGNWKMHGTLVSVRQLAEAVIDGVEKDASLLDRCDFLVCPTFIHIPAVRAVI
DHNRGALRVGGQDCSPHETGAFTGDIAAPMLKDVGCSAVILGHSERRQHHAEGDQTVAAK
AVQAHQAGLMTIICVGETEAQRVAGQEKTIVKQQLDGSIPAGATASNTVIAYEPVWAIGT
GKTATPADVAAMHAFIRGILVGKMADGAGVRILYGGSVKPENAGELLAIPDVDGALIGGA
SLKADQYLAIAKAVQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaagaaaaagctgattgctggaaattggaagatgcacggaacgctggtcagc
gttcgtcaattggccgaggccgtaattgatggcgtggaaaaagatgccagcttgctggat
cgctgcgattttctggtttgccctacctttatccatattccggccgtccgggccgtgatt
gaccataatcgcggcgctttgcgcgttggcgggcaggattgttcgccccatgagacgggt
gcattcaccggggatattgccgcgccgatgctcaaagatgtgggctgttccgccgtaatt
ctgggccattccgagcgccgccagcaccatgcggagggggaccaaaccgtggccgccaag
gcggttcaggcgcatcaggcggggttgatgaccattatctgcgtcggggaaaccgaggcg
cagcgcgtggcgggtcaagaaaaaacaattgtaaaacaacagcttgatggatcgatcccg
gctggggcaacggcatcgaatacggtgattgcctatgaaccggtctgggccattggcacg
ggcaaaacggcgaccccggcggatgttgcagccatgcacgcttttatccgcgggattttg
gtggggaaaatggcggacggggccggggtgcggattttgtatggcgggtcggtaaaaccg
gagaatgccggggaattgctggctattccggatgtggacggggccctgatcggcggggcc
agtttaaaggcggaccaatatctggctattgccaaagcggtgcaataa

DBGET integrated database retrieval system