KEGG   Micavibrio aeruginosavorus ARL-13: MICA_1333Help
Entry
MICA_1333         CDS       T01630                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00900  Terpenoid backbone biosynthesis
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MICA_1333 (dxr)
Enzymes [BR:mai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MICA_1333 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AEP09655
UniProt: G2KSQ5
Position
complement(1328726..1329898)
Genome map
AA seq 390 aa AA seqDB search
MSKRVTILGSTGSVGTSTVDLILNNPEAYDIQALTAQTNVDRLADQAIQLKAKRAVIGDE
THYTALKNRLAGTGIDCAAGRAAVIEAASMPTDWTMAAIVGMAGLEPILAAIAQGQCVAI
ANKEPLVAAGPLVMAAARASGATLLPVDSEHNAVFQVFENENRAGIDRIILTASGGPFRT
WTMDQMRAATPAQAVAHPNWIMGAKISVDSASMMNKALEIIEAHYLFAMPPEQIDVLVHP
QSVIHSMVEYADGSVLAQLGAPDMRTPIAYTLGWPDRIRTSGQRLDLKTLSRLDFEQIDP
VRFPSIPMAYDCLRAGPAHCIAFNAANEVAVAAFLGGQIGFYGIMDAVRYAVERVEKVDM
SNLSDVLDFDGAVRDDTTAYMNSHHALKSA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgcgtaactattctgggatcgaccgggtcggttgggacatcaacggttgat
ttgatcctaaacaatcctgaagcgtatgacatacaggcgttgacggcgcagacgaatgtg
gatcgtctggccgatcaagccattcaactgaaagccaagcgtgccgttatcggcgatgaa
acccattacaccgcattgaaaaaccgcctggccggaacgggtattgactgtgcggccgga
cgtgcggctgtgatcgaagcggctagtatgccgaccgattggaccatggcggcgattgtc
ggcatggcggggctggaacccattctggccgcgattgctcaagggcaatgtgtggcgatt
gcaaacaaggaacccttggtcgctgcgggacccctggtgatggctgctgcgcgggcaagc
ggtgcaacacttctgcctgtggacagtgaacacaacgccgtgtttcaggtttttgaaaat
gaaaaccgtgccggtatcgaccgcattatcctgaccgcctcgggtgggccgttccgcacc
tggacgatggatcaaatgcgcgccgccaccccggcgcaggccgtcgcgcacccgaactgg
atcatgggagccaagatttccgtcgacagtgccagcatgatgaacaaagcgctggagatc
attgaggcgcattatctgttcgccatgccgccggaacagattgacgtgctggtccacccg
caatcggtcattcattccatggtcgaatatgccgatggatcggttttggcccaactgggc
gcgccggatatgcgcacgccgattgcctatactttaggctggccagaccggatcagaacc
agcggccagcggctggatttaaaaacattgtctcggttggatttcgaacagatcgacccg
gtgcgcttcccctctatcccaatggcgtatgattgtttgcgcgctggcccagcccattgc
atagcgttcaacgcggcgaacgaagtggccgttgcggcatttctgggcggtcagatcggg
ttttatggtattatggacgcagtgagatatgcggtcgagcgcgtcgaaaaggtggatatg
tccaatctttctgatgtgctggactttgacggcgctgtgcgcgacgatacaaccgcctat
atgaattctcatcacgcgctgaaaagcgcttaa

DBGET integrated database retrieval system