KEGG   Micavibrio aeruginosavorus ARL-13: MICA_493Help
Entry
MICA_493          CDS       T01630                                 

Definition
(GenBank) nucleotidyl transferase family protein
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00051  Fructose and mannose metabolism
mai00520  Amino sugar and nucleotide sugar metabolism
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MICA_493
   00520 Amino sugar and nucleotide sugar metabolism
    MICA_493
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     MICA_493
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     MICA_493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEP08830
UniProt: G2KLK0
Position
510169..511035
Genome map
AA seq 288 aa AA seqDB search
MLHNIIPVILCGGVGRRLWPLSTPRRPKPFLRDMSGQSLLQQTMDRARGMKPPVIVCNKI
HADLVRRDIGTTSSALLLEPCGRNTAPAMVAAAHYIQREFGSDAVMLIMPSDHFMADPAA
VGRAALTLWPYLDHDIVGVFGVRPTRAETGYGYIQVDVGAHARPGSHAVRSFVEKPDREL
AQTYLDQGCWWWNSGLFLARAKTLLDHAQTHASAAYVATGRAVENGVWDQQALHLSSDFA
DAPAVSFDKAVMERIGGVRVAALETVWSDLGTWSALAKNMCANLFSTG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacaatattattccggttattttgtgcggtggtgtcgggcggcgtttgtggccg
ttatcgacgccgcgtcggcccaaacctttcttacgggatatgtccgggcaatctttgttg
caacagaccatggatcgtgcccgtggcatgaagccccccgttattgtgtgtaataaaatc
catgccgatttggtacgacgggatataggaacgacgtcatcggctcttcttctagagccc
tgtggccggaatacggccccggcgatggtggcggcggcccattatattcagcgtgaattt
ggcagcgatgccgtcatgctgatcatgccatccgatcattttatggccgatccggcggct
gtggggcgggcggcgctgaccttgtggccgtatctggaccatgacattgttggcgtgttt
ggggtgcgtccaacgcgcgccgaaacgggctatggctatattcaggtcgatgtcggtgcg
catgcgcgcccgggatcgcatgctgtgcgctcttttgtcgagaaaccggatcgggaattg
gcgcaaacctatctggatcaggggtgctggtggtggaacagcgggttgtttctggcccgg
gcgaaaactcttcttgatcatgcgcaaacccatgcctccgccgcgtatgtggcaacaggg
cgcgccgttgaaaacggtgtctgggatcagcaggctctgcatctgtccagcgattttgcc
gacgctccggcggtgtcctttgacaaagcggtgatggagcgaatcggcggcgtgcgggtg
gctgcgttggaaaccgtgtggtccgatttgggtacctggtcggcattggccaaaaacatg
tgtgccaacctgttttcaaccggttga

DBGET integrated database retrieval system