KEGG   Micavibrio aeruginosavorus ARL-13: MICA_523Help
Entry
MICA_523          CDS       T01630                                 

Definition
(GenBank) hypothetical protein
Organism
mai  Micavibrio aeruginosavorus ARL-13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_2 DUF3881 Ank_5
Motif
Other DBs
NCBI-ProteinID: AEP08860
UniProt: G2KLN0
Position
543067..543339
Genome map
AA seq 90 aa AA seqDB search
MTISNQDKLFAAARCGDNATIRQLAFSDVDFGARDEKGRTPFNLATQYGHADTAKTILAA
KEMKYMQQLGLVGEGSVAPVREDEAQKAVG
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcagcaaccaggacaaattgtttgccgccgcccggtgcggggataatgccacc
atccgtcaattggcgttcagcgacgttgattttggtgcccgtgatgaaaaggggcgcacg
ccgttcaatctggccacccaatatggtcacgccgatacggccaaaaccatcctggccgct
aaggaaatgaaatatatgcaacagctgggtctggtgggcgagggctccgtggctccagtt
cgcgaagacgaagcccaaaaagctgttggttaa

DBGET integrated database retrieval system