KEGG   Micavibrio aeruginosavorus ARL-13: MICA_559Help
Entry
MICA_559          CDS       T01630                                 

Definition
(GenBank) hypothetical protein
Organism
mai  Micavibrio aeruginosavorus ARL-13
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP08896
UniProt: G2KMW4
Position
complement(575877..576869)
Genome map
AA seq 330 aa AA seqDB search
MATSLPTDMKYFDPLIQTGYTEKITQMIDGFNGQSAGTIVFRSNRKPGDYDYSAFFKNAG
GLVSRQDQTSVSDATSIKLTQDQIISVKLNRKIGPVDWSRAAILKPGLDMDAIKVAAGEQ
AAADALADMLNSSLLAGVAALNNQAAVKYTVPTNGTLNTSSMVSGLSKFGDQANRIQAFV
MHSKVFFDLFQYQVTPANNGDLIANTTIVNGGPVTLNRPILVTDSASLVQTGGTGTGAYT
NYMTLGLTADGLIVDETEEEYMTFQEITGKEQILMRMQGEFGYNLGVKGFKWDVANGGKN
PNAAALGTGSNWDAAFTSSKDFAGCIIQSR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcgacatcccttcctaccgatatgaaatattttgatccgctgatccaaactggatac
acagaaaaaatcacccaaatgatcgatggctttaacggccaatcagcgggcaccattgtt
ttccgtagcaaccgcaaaccgggtgattatgattattcagcgttcttcaagaacgctggt
ggtctggtttcccgtcaggatcaaacatccgtttcggatgcgacgtccattaaactgacg
caagaccagattatcagcgtaaaactgaaccgtaaaatcggcccggttgactggtctcga
gcggcaattctgaagccgggcttggatatggacgctatcaaagttgctgcaggtgaacag
gctgccgctgatgcgttggccgacatgctgaacagttccttgctggctggtgttgccgcc
ctgaacaaccaagcagcggtaaagtacacggttccgacaaacggaaccctgaacacgtcc
tcaatggtttcagggctttccaagttcggggatcaggcaaaccgcattcaggccttcgta
atgcactcgaaggtgttcttcgacctgttccaataccaggtcacgccagccaacaacggc
gacctgattgcgaataccaccattgtcaacggtggcccggtgaccctgaaccgccctatt
ctggtaacggacagtgcgtctctggtgcaaacaggcggcacaggtaccggcgcatacacg
aactacatgaccctcggcctgaccgctgatggcctgatcgtggacgaaaccgaggaagag
tacatgaccttccaagagatcaccgggaaagaacagatccttatgcgtatgcagggtgag
tttgggtacaacctcggcgtcaaaggattcaaatgggatgtggcgaacggcggtaaaaac
ccgaacgctgccgccctcggtaccggatcaaactgggacgccgccttcacatccagcaag
gattttgctggctgcatcattcagtcccgataa

DBGET integrated database retrieval system