KEGG   Micavibrio aeruginosavorus ARL-13: MICA_603Help
Entry
MICA_603          CDS       T01630                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00010  Glycolysis / Gluconeogenesis
mai00052  Galactose metabolism
mai00500  Starch and sucrose metabolism
mai00520  Amino sugar and nucleotide sugar metabolism
mai00521  Streptomycin biosynthesis
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_603 (glk)
   00052 Galactose metabolism
    MICA_603 (glk)
   00500 Starch and sucrose metabolism
    MICA_603 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MICA_603 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MICA_603 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MICA_603 (glk)
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MICA_603 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEP08939
UniProt: G2KN07
Position
602353..603327
Genome map
AA seq 324 aa AA seqDB search
MTATGLIADIGATNARFALVRNGVRNGALENVQVLKCADYATIVDAARAYLAMCGAPDVR
AASFAIAGPVTGDHFTMTNHPWDFSIEQTRLALGLDHFTLMNDFKAVALAIPHLHETDRR
QIGGTQTPVNESPIAVIGPGTGLGVGSLVWDGQAYRAIPGEGGHVTMPAKTQREFDVFQA
LHDKYRHISAERVCSGKGLVNIYNALRIIDHRNDLPDRSPEEISAAALDGSCTLCAEALR
MMIAFLGSIAGNLALTLGAAGGVYIAGGICAQLGEAFFQSDFRDQFESKGRFQSYLAPIP
TYLITHPFIAFIGLQAELKPFLCD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacaggattgattgccgatattggcgcgaccaacgcccgctttgccttagtt
cgtaatggggtgcggaatggcgcgctggagaatgtgcaggttttgaaatgcgccgattac
gccacgatcgtggatgcggcgcgggcgtatctggccatgtgcggcgcgccggatgtgcgg
gcggccagctttgccattgccggcccggtgacgggcgaccatttcaccatgaccaaccat
ccgtgggatttttcgattgagcaaacacgccttgcgttggggctcgaccatttcacgttg
atgaatgattttaaggccgtcgcgctggccattccgcatttgcacgaaacggatcggcgg
caaattggtggcacacaaacgccagtgaatgaatcccccatcgctgtcattggccccggt
accggattgggtgtggggtcactggtctgggatggacaggcttatcgtgcgataccgggt
gagggtggccatgtcaccatgcccgcaaagacgcagcgtgaatttgatgtgtttcaggcc
ctgcacgacaaataccgccatatatccgccgagcgcgtatgttcgggcaaggggttggtg
aatatttacaatgccctgcgtattatcgaccaccgcaatgatttgccggatcgttcaccg
gaggagatcagcgcggccgctcttgatggatcctgcacactctgtgccgaggctctgcgt
atgatgattgccttcttgggcagcattgcgggcaatctggcgctgacgctgggggcggcg
ggtggtgtgtatattgcgggtggaatttgcgcacaactgggcgaggcatttttccaatcc
gatttccgcgatcaatttgaatccaaggggcggttccaatcctatctggcacccattcca
acctatctgatcacgcatcccttcattgcctttatcgggttacaggctgaattaaagccg
ttcttgtgcgattaa

DBGET integrated database retrieval system