KEGG   Micavibrio aeruginosavorus ARL-13: MICA_608Help
Entry
MICA_608          CDS       T01630                                 

Definition
(GenBank) hypothetical protein
Organism
mai  Micavibrio aeruginosavorus ARL-13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YjbH
Motif
Other DBs
NCBI-ProteinID: AEP08944
UniProt: G2KN12
Position
complement(608707..610746)
Genome map
AA seq 679 aa AA seqDB search
MAGLLCAPVPAGAELLPPAAPKDPKPSPNWAGSLGLNTVPSARMDKSGMMRFHLSTLDPY
ATAALSMQIADPLNITLRQNGYVSNLREAADRLYPAVDLKVRLLNESAYRPEIALGLMSA
YGHKQMAAEYLALSKRYNNFDFTGGLGWGRMASAGHFSNPLKVFGSHFERDRDATSEDAN
GPDDWFTGDKIGLFAGVEYFTPINGLSLKADWGADDYSTEALIDPGYDAPDPWSVGLHYQ
PTEHLGFGLGILGGEKIMASVNISGALNDWPYQWEEPSPEDPSTIQIQTTRANDKGVWAN
LYAHDELPIGMQIGRALRHLTEVDPEGPAEIYITPSHYGLTGPTLRMVRRDVAAALSEER
NGSPAEIWRNMTMPAIVPTDLQNAEKVKDLRSPNRPFASFRFILDNQMSLSEEDGGILHR
ESLVQETQLNWPKNITVGGGFRLNFSDDLESLSSQYLPVDKPVRSDVAEFAGALVSVDRL
YGAFMHSLSPDIHTGFTAGYLEEMYAGFGGEILYRPFGKTFAIGAEGWNVWRRDPYSDLV
LDLQDDSTLTGFFNAWYEFPDSDLTAGLKVGRYLGEDFGATVSLDKRMDSGVRVTAFVTA
SEDEDPDIFGGTTHLYSGLRLTLPLGTWRRMVDGSEMRTTIAPLGRNAGQTLDTPLPLYD
VSEPLSYRAISRSWDQLQK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggctggattattgtgtgctccggtccccgccggggcggaattgctgccgcctgccgca
ccgaaggacccaaagcccagcccgaactgggccggatcgctgggattgaatacggttccc
tccgcccgcatggataaatcgggcatgatgcggtttcatctgtccacactcgacccctat
gccaccgccgcattgtcgatgcaaattgcggacccgctgaacatcacgttgcgccagaac
ggatatgtttcaaatttgcgcgaggccgcagaccgattgtatccggcggtggatttgaaa
gtgcgcctgctgaatgaaagcgcctatcgtcctgaaatcgccttgggcttaatgtccgcc
tatggccataaacaaatggcggcggaatatctggccctgtcaaaacgctataataacttt
gactttacaggcggtcttggctggggccgcatggccagcgccgggcatttttccaaccca
ctgaaagtgttcggatcacattttgaacgcgaccgcgatgccaccagcgaagatgccaac
ggccccgatgattggttcacgggggataaaatcggcctgttcgccggggtggaatatttt
acaccgatcaatggcctgtccctgaaagccgattggggagcggatgattattcgacggag
gcgcttatcgaccccggttatgacgcgcccgatccgtggtcggttggattgcattatcaa
cccaccgaacatctgggctttggccttggcatcctgggtggtgaaaaaatcatggccagc
gtgaatatttccggtgccttgaatgattggccctatcaatgggaagaaccttcgccggaa
gatccatcaaccattcaaattcaaaccacccgcgcgaatgataagggtgtatgggccaat
ctatacgcccacgacgaattaccgattggcatgcaaattggccgcgccctgcggcacctg
accgaagtcgatcctgaaggcccggcggaaatttatattacgcccagccattacggcctg
accgggccgaccttgcgcatggtgcgccgtgatgtggccgccgccctgagcgaggagcgc
aatggcagcccggcggaaatctggcgcaacatgaccatgcccgcgattgtgcccaccgac
ctgcaaaacgccgaaaaggtgaaagatctccgcagccccaaccgccccttcgcgtccttc
cgcttcattttggacaatcaaatgagcctgtccgaagaagatggcggcattttgcaccgg
gaatcgctggtgcaggaaacgcaactgaactggccgaaaaatattacggttggtggcggg
ttccggctgaacttttccgatgatctggaatcgctgtcatcgcaatatctgcccgttgat
aaaccggtgcgcagtgatgtcgccgaattcgccggggctttggtatccgttgatcgcctg
tatggcgcgtttatgcacagcctgtcccccgatattcataccggtttcacggccggatat
ctggaggaaatgtatgcgggatttggcggcgaaattctctatcgcccatttggtaaaaca
ttcgccatcggggcggagggatggaatgtctggcggcgcgatccgtatagcgatctggtt
ctggatttacaggacgattcaaccctgaccggctttttcaatgcctggtatgaatttccg
gacagcgacctgaccgccgggttaaaagtgggccgttatctgggtgaagattttggggcg
acggtatcgctggataaacggatggatagcggcgtgcgcgttaccgcctttgtcacggcc
agcgaagatgaagacccggatattttcggcgggactacccatctctatagcggcctgcgc
ctgaccctgccgctcggcacatggcgacgtatggtggatggcagcgaaatgcgcaccacc
attgccccgctgggccggaatgcgggacaaactctggacacgccgttgccgttgtacgac
gtgagcgaaccgctatcctaccgtgccatttcacgcagttgggaccagttgcagaaatag

DBGET integrated database retrieval system