KEGG   Micavibrio aeruginosavorus ARL-13: MICA_614Help
Entry
MICA_614          CDS       T01630                                 

Gene name
maf
Definition
(GenBank) septum formation protein Maf
  KO
K06287  septum formation protein
Organism
mai  Micavibrio aeruginosavorus ARL-13
Brite
KEGG Orthology (KO) [BR:mai00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    MICA_614 (maf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf
Motif
Other DBs
NCBI-ProteinID: AEP08949
UniProt: G2KN17
Position
complement(615865..616431)
Genome map
AA seq 188 aa AA seqDB search
MVLASASPRRLDLLAQMGITPDHIAPADLDETPLKAETPDAHALRLAIEKARAVAAKHPA
SIVLAADTVVACGRRILPKAESEAQARECLKILSGRRHRVYNGICVIGADGTEHTAITNT
IVRIKALSRVEAESYIASGEWHGKAGGYAIQGRAAAFIPFISGSYSTIVGLSLYDTMRLL
NRAGYSQD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggttttggcctcggcgtcgccgcgccgtctggaccttctggcccagatgggcattacc
cccgatcacatcgcccccgctgatcttgatgaaacgccgttgaaggcggaaacgccggac
gcgcacgcgttgcgcctggcgattgagaaagcccgcgccgtggccgccaaacaccccgca
tccatcgttcttgccgccgatacggtcgtcgcctgtggccgccgcattttgcccaaggcc
gagagcgaagcgcaagcgcgcgaatgtttgaaaatcctctccggccgtcgccaccgtgtt
tataacggcatttgcgtgattggcgcggatggcacggagcacacggccatcaccaacacc
atcgtgcggatcaaggccctgtcccgcgttgaagccgaatcctatatcgccagtggcgaa
tggcacggcaaggcgggcggttacgccattcagggccgcgccgccgcattcattcccttt
atcagcgggtcatactccacaattgtcgggttgtccctgtatgatacaatgcgtctgttg
aatcgtgcagggtacagtcaggattaa

DBGET integrated database retrieval system