KEGG   Micavibrio aeruginosavorus ARL-13: MICA_623Help
Entry
MICA_623          CDS       T01630                                 

Definition
(GenBank) glyoxalase/Bleomycin resistance/Dioxygenase superfamily protein
Organism
mai  Micavibrio aeruginosavorus ARL-13
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 FAM124
Motif
Other DBs
NCBI-ProteinID: AEP08957
UniProt: G2KN25
Position
complement(621119..621562)
Genome map
AA seq 147 aa AA seqDB search
MKRLHIHLGVKNIDDSVRFYSALFGADPVKHKPDYAKWMLDDPHVNFAISTRAGKTGVDH
MGIQVDTADELNAIRTQMSDANISTHSDGETTCCYAKSEKSWVEDPNGIAWEAYHTMEDA
QIFSAADTSSESGACCVPTTKSGSCCG
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcttacacattcaccttggcgtaaaaaatattgatgacagtgtgcggttttat
tccgccctgttcggggccgatccggtcaaacacaaaccggattacgcgaaatggatgctg
gatgacccgcacgtcaatttcgccatctccacccgcgcgggaaaaaccggcgtggaccat
atgggcattcaggtcgatacggccgatgaattaaacgccatccgcacccagatgtcggat
gcgaatatcagcacgcacagcgacggcgaaacaacttgctgctacgccaaatccgaaaaa
tcatgggtcgaagatccgaatggcattgcatgggaagcctaccacaccatggaggatgca
cagattttctccgccgccgatacatcatcagaaagcggtgcgtgctgcgttcccactaca
aaaagcgggagctgctgcggataa

DBGET integrated database retrieval system