KEGG   Micavibrio aeruginosavorus ARL-13: MICA_858Help
Entry
MICA_858          CDS       T01630                                 

Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00071  Fatty acid degradation
mai00072  Synthesis and degradation of ketone bodies
mai00280  Valine, leucine and isoleucine degradation
mai00310  Lysine degradation
mai00362  Benzoate degradation
mai00380  Tryptophan metabolism
mai00620  Pyruvate metabolism
mai00630  Glyoxylate and dicarboxylate metabolism
mai00640  Propanoate metabolism
mai00650  Butanoate metabolism
mai00900  Terpenoid backbone biosynthesis
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
mai01212  Fatty acid metabolism
mai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MICA_858
   00630 Glyoxylate and dicarboxylate metabolism
    MICA_858
   00640 Propanoate metabolism
    MICA_858
   00650 Butanoate metabolism
    MICA_858
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MICA_858
   00072 Synthesis and degradation of ketone bodies
    MICA_858
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MICA_858
   00310 Lysine degradation
    MICA_858
   00380 Tryptophan metabolism
    MICA_858
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MICA_858
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MICA_858
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MICA_858
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mai04147]
    MICA_858
Enzymes [BR:mai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MICA_858
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICA_858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEP09191
UniProt: G2KRE4
Position
848795..849967
Genome map
AA seq 390 aa AA seqDB search
MSSHTQDPIVIVGMARTPMGGFQGDFANLTAPELGAAAIRAALQRSGVAGVDEVIMGNVL
SAGQGQAPARQASIGAGIPNSVGCTTINKMCGSGLKAVMLAHDLITAGTNDVMIAGGMES
MTNAPYLLPKARGGYRMGHGQVIDHMFLDGLEDAYDRGKLMGVFAELCAGEYKFTREAQD
AFAIESLARAQKADFTAEIVPVTVKVGKEEKIISIDEQPGKARPDKIPGLKPAFKPDGTV
TAANASSISDGAAALVLMRRSAAEKGGHKILATIAGHSTFAHEPAWFTTAPVGALKKLSD
KTGWAMKAVDLFEINEAFAVVTMAAMKDLDLPHDKVNVHGGACALGHPIGASGARVLVTL
IAALEKYDLKRGMATLCIGGGEAVAVAVER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcacacacaggaccctattgttatcgttggcatggcccgcaccccgatgggt
gggtttcagggcgatttcgccaatctgaccgccccggaattgggcgcggccgccattcgt
gcggcattgcaacgatccggcgtggcaggggtggatgaggtcatcatgggcaatgtcctg
tccgccgggcagggacaagccccggcgcggcaagcatcgatcggtgcaggcattcccaat
tccgtgggctgtaccaccatcaataaaatgtgtggatcggggttgaaggctgtcatgctg
gcgcatgatttgatcacagccggaaccaatgacgtgatgatcgcggggggcatggaaagc
atgaccaatgcgccatacctgttgcccaaggcgcgtggcgggtaccgcatggggcatggt
caggtgattgaccatatgtttttggacggtctggaagatgcgtatgaccgtggcaagttg
atgggtgttttcgcggagttgtgcgccggtgaatataaattcacgcgtgaagcccaggat
gcctttgccattgaatcgctggcccgtgcgcaaaaagccgatttcacggcggagattgtt
cccgtgacggtcaaggttggcaaagaagaaaaaattatctccatcgacgaacagccgggc
aaagcccgcccggataaaattccgggactgaagcctgcgtttaaaccggatggcacggtc
acggcggcgaatgcaagctcgatttccgatggtgcggcggcgcttgtattgatgcgccga
agtgcggcggagaaaggtggtcataaaattctggccacgatcgccggtcattcaaccttt
gcccatgaaccggcatggttcaccaccgcccccgttggtgcgttgaaaaaattgtccgat
aaaaccggatgggcgatgaaggctgtcgatctgtttgaaatcaacgaggcctttgccgtc
gtgaccatggccgcaatgaaggacctggatctgccgcatgacaaggtgaacgtccatggc
ggggcctgtgcccttggtcacccgattggggcatccggcgcgcgcgtgttggtgacgttg
attgcggcgctggaaaaatacgacctgaaacgcggtatggcgacattgtgcatcggtggc
ggtgaagccgtggctgtggctgtagagcgctga

DBGET integrated database retrieval system