KEGG   Micavibrio aeruginosavorus ARL-13: MICA_962Help
Entry
MICA_962          CDS       T01630                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00071  Fatty acid degradation
mai00072  Synthesis and degradation of ketone bodies
mai00280  Valine, leucine and isoleucine degradation
mai00310  Lysine degradation
mai00362  Benzoate degradation
mai00380  Tryptophan metabolism
mai00620  Pyruvate metabolism
mai00630  Glyoxylate and dicarboxylate metabolism
mai00640  Propanoate metabolism
mai00650  Butanoate metabolism
mai00900  Terpenoid backbone biosynthesis
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
mai01200  Carbon metabolism
mai01212  Fatty acid metabolism
mai02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MICA_962 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MICA_962 (phbA)
   00640 Propanoate metabolism
    MICA_962 (phbA)
   00650 Butanoate metabolism
    MICA_962 (phbA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MICA_962 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MICA_962 (phbA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MICA_962 (phbA)
   00310 Lysine degradation
    MICA_962 (phbA)
   00380 Tryptophan metabolism
    MICA_962 (phbA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MICA_962 (phbA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MICA_962 (phbA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MICA_962 (phbA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mai04147]
    MICA_962 (phbA)
Enzymes [BR:mai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MICA_962 (phbA)
Exosome [BR:mai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICA_962 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FKBP_N Robl_LC7 7TMR-HDED
Motif
Other DBs
NCBI-ProteinID: AEP09293
UniProt: G2KLR4
Position
958735..959946
Genome map
AA seq 403 aa AA seqDB search
MTTNDPIVIVAAKRTPIGNFNGGLSTLPAHDLGAVAIRAVMDEAKVGGADIDEVIMGQVL
TAAAGQNPARQAAMAAGIPHDKTALTVNQVCGSGLRTVALGMQSILNGDATVIVAGGQEN
MSLSPHAMHMRNGTKMGNATMVDTMIVDGLWDAFNGYHMGMTAENIAEKWQITRADQDNF
AAASQQKTEAAQKAGKFTAEITPVKIKVKKDEVIIDKDEFPRAGVTVESLAGLRPAFKPD
GTVTAASASGINDGAAAVVLMRASEAKKRGLPVYATIRSWATAGVDPAVMGSGPIPASRK
ALEKAGWSVSDLDLVEANEAFAAQSLCVLKDLALDPAKVNVNGGAIAIGHPIGASGTRVL
VTLLHEMARRDVKRGLVTLCIGGGMGIAMCVERDASENLKKVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgaatgatcccatcgttatcgtcgccgccaaacgcacacccattggtaatttc
aatggtggcctcagcacgttgcccgcgcatgatctgggcgcggtggcaatccgcgcggtt
atggatgaagccaaagtcggcggtgccgatattgacgaagtgattatggggcaggttctc
accgccgccgccggacaaaacccggcacgtcaggctgcaatggctgcgggtatcccgcat
gacaaaaccgcactgaccgtgaaccaggtgtgtgggtctggcctgcgcactgtggcgctt
ggcatgcaatccattctgaatggtgatgcaaccgtcatcgttgcaggcgggcaagagaat
atgagcctgtccccgcacgctatgcacatgcgcaacggtacgaagatgggcaacgccacg
atggttgacacgatgatcgtcgatggcctgtgggacgcattcaacggctaccacatgggc
atgaccgccgaaaacattgccgagaaatggcaaattacacgtgcggatcaggataatttt
gccgctgcatcccagcaaaaaaccgaagccgcgcaaaaggccggtaaattcaccgccgaa
atcaccccggtgaaaatcaaggtgaagaaggatgaagtgatcattgataaagacgaattc
ccgcgcgcaggcgtgacggttgaatctctggcgggcttgcgcccggccttcaaaccggac
ggcaccgtgacggcggccagcgcatccggcatcaatgatggtgccgccgccgttgttctg
atgcgcgccagcgaagcgaagaagcgtggccttccggtttatgcgaccattcggtcctgg
gccacggcgggtgttgatccggcggtgatgggctccggtccgatcccggcatcgcgcaag
gcgttggaaaaagcgggctggtccgtatccgacctggatctggtcgaagcgaacgaagct
ttcgccgcacaatctctgtgcgtgttgaaggatctggcgttggacccggcgaaggtcaac
gtgaatggtggggccattgccatcggtcacccgattggtgcatcgggcacacgcgttctg
gtcacgctgctgcatgaaatggcgcgccgtgatgtgaaacgcggtctggtgacattgtgc
atcggcggcggcatggggattgccatgtgcgttgagcgcgatgcctccgaaaatctgaaa
aaagttgcttaa

DBGET integrated database retrieval system