KEGG   Micavibrio aeruginosavorus ARL-13: MICA_969Help
Entry
MICA_969          CDS       T01630                                 

Definition
(GenBank) phosphofructokinase family protein
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
mai00010  Glycolysis / Gluconeogenesis
mai00030  Pentose phosphate pathway
mai00051  Fructose and mannose metabolism
mai00052  Galactose metabolism
mai00680  Methane metabolism
mai01100  Metabolic pathways
mai01110  Biosynthesis of secondary metabolites
mai01120  Microbial metabolism in diverse environments
mai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MICA_969
   00030 Pentose phosphate pathway
    MICA_969
   00051 Fructose and mannose metabolism
    MICA_969
   00052 Galactose metabolism
    MICA_969
  Energy metabolism
   00680 Methane metabolism
    MICA_969
Enzymes [BR:mai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MICA_969
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MICA_969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AEP09300
UniProt: G2KLS1
Position
967103..968182
Genome map
AA seq 359 aa AA seqDB search
MAAKRIGILTSGGDCAGLNAIIRGAVHAAHKKGWETVGILNGTAGLFKTPPAVRTLTPLE
IDGQIMRQGGTILGTTNKGNPFAFPMADGSLKDRSGEIVDGFKALGLDAIIGIGGDGSFA
ILSKLAKQGGINMVGIPKTIDNDIGMTEFSVGFDTAVAVATEALDRLQPTAASHDRVMIL
EVMGRDAGHIALAAGIAGGADVILIPEIPYSIESVAKKIKAVKDSGRNFALVVVSEAVKT
TDGGKVQTEYTDGEKRYGGIGQYIGAQIAEATGSETRVTVLGHVQRGCPPSYNDRLLGTA
FAVKAVDLIEEGKFGRMVAWQNRQVIDVAIEDAIAAYQQVDIDSTLVHTCRALGISLGD
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaaacgcatcggtattctgaccagtggcggcgattgcgcggggttgaacgcg
attattcggggcgcggttcacgccgcccataaaaagggctgggaaaccgttggtattctg
aacggcacagcgggtttgtttaaaacgcctccggctgtgcgcacgctgaccccgctggaa
attgacgggcagatcatgcgccaggggggcacgattctggggaccacgaacaagggcaac
ccgttcgcgttcccgatggcggatgggtcgttgaaggatcgttcgggcgaaatcgtcgac
gggttcaaggctctggggctggacgccattatcggtatcggcggtgacggcagcttcgcg
attttaagcaagctggcgaagcagggcggcatcaacatggtgggcatcccgaaaaccatt
gataacgatatcggcatgaccgaattttccgtcggttttgatacggctgttgcggttgcg
accgaggcgctggatcgcctgcaacccacagcggccagccatgaccgcgtgatgattttg
gaagtcatgggccgcgatgcgggccatatcgctctggccgccggtattgcgggcggtgcg
gatgtcatcctgatccctgaaattccatatagcatcgaaagcgtggcgaagaagatcaag
gccgtgaaggattccggccgtaacttcgctctggtcgttgtctccgaagccgtaaaaacg
accgatggcggcaaagttcaaaccgaatacacagacggcgaaaagcgctatggcggtatt
ggccagtacatcggcgcgcaaattgccgaggccacagggtccgaaacccgcgtcacggtg
ctgggtcacgtgcaacgcggatgcccgccaagctataatgaccgtttgctgggcaccgcc
tttgcggtcaaggccgttgatttgatcgaagagggtaaattcgggcgtatggtggcctgg
cagaatcgccaggtgatcgatgtggcgatcgaagatgccatcgccgcgtatcagcaggtg
gatattgacagcactttggtgcatacttgtcgtgcactggggatttctttgggggactga

DBGET integrated database retrieval system