KEGG   Metarhizium robertsii: MAA_01047Help
Entry
MAA_01047         CDS       T03107                                 

Definition
(RefSeq) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
maj  Metarhizium robertsii
Pathway
maj00970  Aminoacyl-tRNA biosynthesis
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MAA_01047
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:maj03029]
    MAA_01047
Enzymes [BR:maj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MAA_01047
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MAA_01047
Mitochondrial biogenesis [BR:maj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MAA_01047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 19255333
NCBI-ProteinID: XP_007817236
UniProt: E9ELJ5
AA seq 481 aa AA seqDB search
MPQCRSQSTSCNHFVDSERIHPASPPPQLLPSAKPFRLAVKDNIATAEFPTQCASRILRG
HKSPYEATVVTQLRARGGIVVGKTNMDEFGMGSHATNSMHGAVSNHLSTDEPISAGGSSG
GSAVAVMLGEADIALGTDTGGSIRLPASYTGAVGYRPSYGMISRYGVFPYANSLDTVGML
AREVKPILHLLVETKLDEEHDPNDPTSLSPASRRRCAKACPPLLEDMSKLTVGIPLEYNV
AELDPIMRQAWAEAATALESAGVNIVPVSLPSTKEALCAYYVLAPAEASSNLAKYDGVRY
GARGEHGDAGGDTLYSETRGAGFGPEVRRRILLGTYSLSSEAMDNYFVQAQKVRRLIRQD
FDKVFKRDNPLQEAAQFDLSDMDAETALQDKQGPPQVDFLLSPTAMSFAPTLNDVLTKSS
LEAYMGDVFTVPASLAGLPAVSVPSGRVGEGRLPLGLQLIGQYWDDKRVLAMAERLKALA
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagtgtcgctcccagagcacaagctgcaatcactttgtggacagtgaaagaata
cacccagcctctcctccgccgcagctgctcccttctgcgaagcccttcaggctcgccgtc
aaggacaacattgcaacggccgagttcccgacacaatgcgcctctcgcatcctccgcggc
cacaaatcaccttacgaagctacagtcgtcacccagctgcgtgcgcgtggcggcatcgtc
gtgggaaagaccaacatggacgagttcggcatgggctcccacgcgacaaactccatgcat
ggcgccgtgagcaaccacctttccacggatgagccaatctccgcggggggcagctctggg
ggcagtgccgttgctgtcatgctcggggaagcggatatcgccctgggaaccgacacgggc
ggttcaatccgtctgcctgcgtcgtacacgggagctgtaggctaccgcccgagctacggc
atgatttcgcgctacggcgtgtttccctacgccaactcactggacactgtgggaatgctg
gccagagaggtgaagccaattctccatcttctagtggaaaccaagctggacgaggagcac
gaccccaacgacccgacgtcattatctccagcctcgaggcgacgatgcgccaaagcatgc
ccgccgcttctggaagacatgtccaagctcactgttggcattcccctggaatacaacgtt
gccgagctggaccccatcatgcgacaggcttgggcggaagctgccacagcgctggagtcg
gccggcgtgaacatcgtgccggtgtctctgccgtcaaccaaggaggcactatgcgcgtac
tacgtccttgcccccgccgaggcatcctccaacctcgccaagtacgacggcgttcgttac
ggcgcgcgaggggagcacggagacgccgggggcgacacgttgtactcggaaacccgggga
gccggcttcggccccgaggtcaggcgtcgcatcttgctgggcacctacagtctcagctct
gaagcaatggacaattactttgtccaggcgcaaaaggtccgccggctgatccggcaggac
tttgacaaggtgttcaaacgggacaacccgctccaagaagcggcgcagtttgacctcagc
gacatggatgccgagacggctctgcaggacaagcagggtcctccgcaggtagacttcctc
ctgtcgccgactgcgatgtcattcgcgccgacgctgaatgacgtgcttacaaagagcagt
ttggaggcgtacatgggggatgtcttcaccgtgcccgcaagtctggctggcctacctgcc
gtcagcgtgccgtcgggaagggtcggggagggtcggttgccgttgggactccagttgatt
gggcagtattgggatgataagcgggtgttggccatggcggagagattaaaggcgctggcg
gcatag

DBGET integrated database retrieval system