KEGG   Metarhizium robertsii: MAA_01165Help
Entry
MAA_01165         CDS       T03107                                 

Definition
(RefSeq) pyridoxal-dependent decarboxylase-like protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
maj  Metarhizium robertsii
Pathway
maj00350  Tyrosine metabolism
maj00360  Phenylalanine metabolism
maj00380  Tryptophan metabolism
maj00901  Indole alkaloid biosynthesis
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    MAA_01165
   00360 Phenylalanine metabolism
    MAA_01165
   00380 Tryptophan metabolism
    MAA_01165
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    MAA_01165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:maj04147]
    MAA_01165
Enzymes [BR:maj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     MAA_01165
    4.1.1.105  L-tryptophan decarboxylase
     MAA_01165
Exosome [BR:maj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAA_01165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 19255451
NCBI-ProteinID: XP_007817354
UniProt: E9EN27
AA seq 499 aa AA seqDB search
MDTNEFRTAAKAAIDEIADYHDNVSSKRVVSDVQPGYLRRLLPSSAPLDPEPFDAIRADI
QDKIMPGITHWSSPGFMAFFPCSSSYPSAIAEMYSNAFSGAHFNWICSPAVTELETIVLD
WIAQALGLPECYTSSGSTHGGGVLHGSASEAILTVMVGARDKYIAAKTAHLPDGEDKEEE
VWRLRSKLVALGSAGAHSSTKKAAQVLGVRFATVPIYEEDGLAMKGESLAKTLDELAAKG
LEPFYLTTTMGTTDVCAVDDFAGIASVLQGRIAAGKTELFVHVDAAYAGSALLLPENQHI
AAPLVHFHSFNFNPHKWMLTTFDCSATFVRSRADLITALSIKPPYLRNQFSDNELVTDYR
DWQIPLGRRFRSLKLWFVLRSYGISGLQAHIRNGVAMGEKLEERLRRRRDLFTVFTASRF
GLVSLRVSGKDEDEVNARTEKVYEAVNAGGSFYLTSTVVNGKFAIRVCLGVPTVREEHVQ
GVFEALVKEAERVCGDLPN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaacgagtttagaacggcggccaaggcggctattgacgagattgccgactac
catgacaatgtctcctccaagcgtgtcgtctccgacgtccagcccggctatctacgccgc
ttgctcccttcgtcggcgccgctagacccggagccgttcgacgccatccgcgccgatatc
caggacaagatcatgccgggcatcacgcactggtccagtcccggcttcatggccttcttc
ccctgctcgagcagctacccgtccgccattgccgagatgtactccaacgccttcagcggc
gcccacttcaactggatctgcagccctgccgtcacggagctcgagaccattgtgctcgac
tggatcgcccaggccctcggcctcccggagtgctacacatccagcgggagcacccacggc
ggcggcgtcctgcatggctcggccagcgaggccatcctcaccgtcatggttggcgcgcga
gacaagtacattgccgccaagacggcacacctccccgacggcgaagacaaggaggaggag
gtatggcgcctgcggagcaagctcgtcgccctgggcagcgccggcgcgcactcgagcacc
aagaaggccgcccaggtgctcggcgtgcgcttcgccaccgtccccatctacgaggaggac
gggctggccatgaagggcgagtccctggccaagacgctcgacgagctcgccgccaagggc
ctggagcccttctacctcaccaccaccatgggcaccaccgacgtctgcgccgtcgacgac
tttgccggcatcgcgagcgtcctccagggccggatcgcggccggcaagacggagctgttc
gtccacgtcgacgccgcctacgccggctcggcgctcctcctcccggagaaccagcacatc
gccgcgccgctcgtgcacttccactcgttcaacttcaacccgcacaagtggatgctcacc
acgtttgactgcagcgcgacgtttgtgcgctcccgcgccgacctcatcaccgcgctgagc
atcaagccgccgtacctccgcaaccagttctccgacaacgagctcgtcaccgactacagg
gactggcagatccccctgggccggcgcttccgctcgctcaagctgtggttcgtcctgcgc
agctacggcataagcggcctgcaggcgcacattcgcaacggcgtggccatgggcgagaag
ctcgaggagaggctgcgccgcagaagggacctgtttaccgtctttaccgcctcgaggttc
ggcctggtctcgctgcgcgtcagcgggaaggacgaggacgaggtgaatgcgcgcacggag
aaggtgtacgaggctgtgaatgccggcggcagcttctacctgacgagcaccgttgtcaac
ggcaagtttgccattagggtgtgcttgggggtgcccaccgtgcgggaggagcatgtgcag
ggcgtgtttgaggccttggtcaaggaggccgagagggtctgtggcgacttgccgaattag

DBGET integrated database retrieval system