KEGG   Metarhizium robertsii: MAA_02741Help
Entry
MAA_02741         CDS       T03107                                 

Definition
(RefSeq) beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
maj  Metarhizium robertsii
Pathway
maj00052  Galactose metabolism
maj00500  Starch and sucrose metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MAA_02741
   00500 Starch and sucrose metabolism
    MAA_02741
Enzymes [BR:maj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MAA_02741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19257027
NCBI-ProteinID: XP_007818930
UniProt: E9ERZ5
AA seq 573 aa AA seqDB search
MLPISTNIHTTLLGALYLANWCLGHNSTQYVGAHVPSGTSIVGSYGGQYRPQVHFSPPRH
FMNDPNGMFRDHNGTWHLYYQYNPTKSVAGNQHWGHATSQDLYHWTNQPIALFPPKKNVY
IFSGSAVIDKNNTSGFFGNQSNGVVAIYTLAEYLDDGSPGPQSQAIAYSYDSGFTFTPYD
GNPVIPSNSSQFRDPKVVWYEDHWVMVVAYAQEFSIGIFTSPDLIEWTHASNFSNQGLLG
LQWECPNLVRMPLYTEDGQRRDDMWTMLISINPGAPVGGSITEYYPGTFNGTHFEAVDSV
ARIADFGKDNYAGQFFFGVQDEEDPVSIAWASNWQYTQTVPTAQEGWRSAMSLPRRNYLT
RIDRVGWKLISSPYDMQPIMGRNLAYNQSLVNGSLTVDFSDIASNAVYWEVNVTGLPKKG
VPEMATLNFTLLSPITAEYIRGGYYFGGDNPFYLDRGGAKGFDNVFFTDKLSTNSLFRNG
SWSMKGVMDRSILELFLNDGVDSATATFFATQPLTFLIISTSSLPHGTRVSTRVNALKST
WQQMEDPGDGLVHGNISMQETASEAMKHLLQSM
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctataagcaccaacattcacacgacacttcttggtgctctgtaccttgcgaac
tggtgtcttggacacaattctactcagtacgttggagcccatgtcccatccggcacatcc
atcgttggcagctatggagggcaatatcgtcctcaagtgcacttttcgccccccaggcac
ttcatgaatgacccgaatggcatgtttcgagaccacaacggcacatggcacctctattac
cagtacaaccccacaaagagtgttgcgggaaatcagcattggggacatgcgacctcccaa
gatttatatcattggacaaaccaaccaattgctctgttccccccgaagaagaatgtatac
atcttttctggaagtgcagtcattgacaagaacaacacttctggtttcttcggcaaccag
tccaatggcgttgttgcaatttatacattggcagaatatttagatgacggcagccccggc
ccccaatctcaggccatcgcctactcgtatgacagtggcttcaccttcaccccgtatgac
ggcaaccctgtcataccgagcaactcctcgcagtttcgcgatccaaaagtcgtctggtac
gaagaccactgggtaatggtggttgcttacgcccaggaattctcaattggcatattcacc
tcaccagatctgatcgagtggactcatgccagcaacttctccaatcaaggtcttctgggt
ctgcagtgggaatgcccaaacctagtgcgcatgccgctgtacacggaagacggacaaaga
cgagacgatatgtggactatgctaatcagcatcaacccaggggcgccggtgggtggttct
attacagaatactaccctggaacttttaacgggacccattttgaagcagttgattcagtt
gcccgcattgccgattttggcaaggacaattatgccgggcagttcttttttggtgtccaa
gacgaagaagatcccgtgtctattgcctgggcatctaattggcagtatacccagactgtt
ccgactgcacaggagggctggcgtagtgcaatgagtctccctcgccggaattacttgaca
agaattgaccgtgttggctggaaactgataagcagcccgtatgatatgcagccaatcatg
gggagaaatctagcgtataaccagagccttgtcaacggatccttgacggttgacttttca
gacatagcctccaatgcggtgtactgggaggtgaatgtgactggcttaccaaagaaaggg
gtaccggaaatggccaccttgaatttcacgcttcttagtcctataacagcagagtacatc
agaggagggtattactttggcggcgacaatccgttctatcttgacagagggggtgcaaaa
ggcttcgacaacgtctttttcactgacaagctatctacaaatagtttgttccgtaacggt
agctggtcgatgaagggagtgatggatcggtccatacttgaattatttctcaatgacggc
gtcgacagtgctacagcgactttcttcgccacacaaccgttgacgttcttgatcatcagt
acgtccagtttgcctcacggcacacgggtaagcactcgtgtcaatgctttaaaaagtacc
tggcagcagatggaagacccaggagatggcttggtgcacggaaacatctccatgcaggaa
acggcctcagaggccatgaagcacttgctgcaatccatgtga

DBGET integrated database retrieval system