KEGG   Metarhizium robertsii: MAA_03454Help
Entry
MAA_03454         CDS       T03107                                 

Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
maj  Metarhizium robertsii
Pathway
maj04111  Cell cycle - yeast
maj04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:maj00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    MAA_03454
   04113 Meiosis - yeast
    MAA_03454
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:maj01002]
    MAA_03454
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:maj03036]
    MAA_03454
Enzymes [BR:maj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     MAA_03454
Peptidases [BR:maj01002]
 Cysteine Peptidases
  Family C50: separase family
   MAA_03454
Chromosome and associated proteins [BR:maj03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    MAA_03454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT RPN7 TPR_MalT TPR_12 DUF1266
Motif
Other DBs
NCBI-GeneID: 19257740
NCBI-ProteinID: XP_007819643
UniProt: E9ETV5
AA seq 2089 aa AA seqDB search
MACTPATVVTLKELLLLETESSAQVTKSASRTAKSTRTAKSSKASTASRKPSAAHSRSEQ
LNSRDRTILATHIINATLKALTEASRPAPPSTPCKQVENVPQLASKRTLRRSLSAPLSPM
QPRTLNRVATSPNVSITKARVGLSAHSTGCLAVVECARVAFASLRSLKPSTQEAQYDFQV
ENGMSAFIGKLLALNMHDQALKELKILKSRLDPATGTESSKVATSTSAEIKLGATRIAEL
LEFRTKISLQTLPIITSFQIQLVKLIGATKKPAHIEALLPMLLEKHVSSPVNLLLKHADS
GDKQTQKAARQMASFSQALLSMLPSVSSQEDEVAVEPRLSPSPQSTFELQALAFRTQLRW
WKLAGHQGSIDDDVLAPFSRCMRAFARRHVSDDKLLYRSLLAAYEELMQLIRSHKPDPSI
SSKSPLSSIYQVLGSTAHAARQYDGACCWFESLKATLSPESDSAVVLCSVSARILATALK
KPKLDDDIEKAIQEVIDSLEGSLSGTLTELNELLESLSATRRSVVGLLMKELDPKAVSDP
IPQTTSTLLNNFVLRYPRFLRRWIGTAPGKDAPAKQTLQFDQRKQAVMQSINQTLDATLM
VVKCGIQSGALEWHQIDDVLQHCSGLLDSICDPLLSPARVEQLGGYHVKISTLYFSKFME
LRKMKHRTKDLNKQLLQSLSRSIDAVKERSSSLKDKAQLSMKLELFADLCKGSGRSEDAV
GTLRSICTNMAEDGVLSDVAAALASLPPTLAWATTDKASSLSRTLRSIAKLDKSWNDWTF
FLPEAERAAVLEHLMHLSTESAGQREPLRLHDPSPAALLRIYSLDKYPIRRFRVLLHLLY
QNIGEDEELAEITSNLGQVSQQLQKRDKGEDGSLTQFIPHLQAYHSSLAALADSDNEFPT
SVVKGNITCWKAILGSYQSKDDLYTKIDNPQTLIDFLQTLNHLADLRGETELQISISELS
IAMAKAVAEYSGSFDDGLILHSSHLAIQYIGIGKFSQASGALEVSKELLEHNEGVSQRVV
ADFYLSQAEYYAGVGSLDEALIYVNKANDICYQSYSSWAQSKYQANLMISLSALIQSTVS
IQTGNIEDALSSIRTGVRTLSHDWAKLEAASSEPDSNMSGNRLIGLDLKTSQVKRTGPRF
WGLAVPLLRCLLHISSVYAHIGMFQETIYYAESAWKIAQSTQSSLYCAQVTAWTGSIYLK
AGNITKAIETLADAQRHIPSNICSSRVHFARKLGELYSEIGDEDKANEYLTMAEETLRLM
DNNPGNSVCIEKSAAPMEKAKTTAAKTSRTARTAKAKPASVTRPTRRPATTKAQAITAEA
VAQLPKDIYQSSLLAAVLLSRAIGYIQKKDWSSALSTLDQAKELPKLFGTLSLEQIVTAT
SLIGHSMEQMISDPVFSVMQDSTISFPAVASSAGRASMDKNNLVASPPRRGRAAAGDRKT
AKDKSGPAFADALRQAQDILIEAHASTLSTSDSGMVHRLSTLLQSTIILLSATSASKTKP
VLSSGLATVAVDLGRNITWTREQITLLNTLRPLGASLPSVPDDPPTSLRKTIMSLTPDMA
AFQKNYVDLLPNNWNVISLSLSDSSRDLSITKLQAGHSPFILRLPLERANSRDADAEVFN
FEHGREELLDIIKLANETSHSARDFSAKGERSAWWAEREALDTRLKDLLSTVESTWLGGF
KGIFSQHQRRTDLLARFQKSFQQILDGSLPSRNRIRGKKTTKASSVNLDPRILDLFIGLG
DPTHPDCDFDEALNDLLYFVVDILQFHGERNAYDEIDFDAMVVETYDALRGYYSALNAGS
ERQEGSHTILILDKALHAFPWESLPCMEGLALSRVPSLACLRQLITESNTQGAEPELQEG
HCVSPKAGTYILNPSSDLKNTQAFFQSTFETLKSWDGIVNKTPQESEFEDALSKSEILLY
FGHGSGAQYIRGKTVRRLEKCRATTFLMGCSSAALTEAGEFECYGPVWNYMMAGCPAVVG
TLWDVTDRDIDRFAGRTFEEWGLFARGTFEKGDRKKGRGKKGGVNDVDTDSGDDDIDSEA
PSRPTSPRLARGSSLPEAVAKARDACKFKYLNAAAVVVYGIPVYINREG
NT seq 6270 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcacaccagccactgttgtaacactcaaagaattgctccttctcgaaacggaa
tcatctgcgcaggtaacaaaatcggcatccagaacggctaaatcaactagaacggcgaaa
tcatcaaaagccagcaccgcgtcgaggaaaccttcagctgcgcattcacgtagtgaacaa
ttgaactcgagagaccggaccatcctagcaacacacatcatcaatgcaacgttaaaggca
ctcacggaagcttcgagacctgcgcctccatcaacgccttgcaaacaggttgagaatgtt
cctcagttagcttcgaaacgaaccctacggcgctcactatcggcaccattgtcaccaatg
cagccgagaaccttgaatcgtgtggcaacctcaccaaatgtctctataaccaaggccagg
gttggtttgtctgctcactctacaggatgtttagcggttgtcgagtgcgcacgagtagcc
tttgcttcccttcgatcactaaaaccttcaacacaagaggctcaatacgacttccaggtg
gaaaatggcatgtctgcgtttataggaaaactcctagctttgaatatgcatgaccaggcg
ttgaaggaattgaaaatattaaaatctcgattggaccctgctaccggtactgaaagctcg
aaagtcgctacatcaacgtctgccgagatcaagttgggtgctacgcggatcgccgaacta
ctcgaatttcggacaaaaatttcactccaaacgcttccaatcatcacttctttccaaatc
cagcttgtcaaacttattggtgctacgaaaaaacctgctcatatcgaggcactactacct
atgctgctggaaaagcatgtatcgtcccctgtcaatctgctcttaaagcacgcggattcc
ggagacaagcaaactcagaaagctgctcgtcaaatggcttcattttcacaagccctacta
tcaatgctaccaagcgtgtctagtcaggaggatgaggtggcagttgagccccggttaagt
cccagcccacagagcacctttgagctccaagctttggcatttagaacacaattgaggtgg
tggaagttggctggacatcaaggcagcattgacgatgatgttttagccccgtttagccgc
tgtatgcgagctttcgcgagacgccatgtatccgacgacaaacttctgtatcggtcccta
ctagcagcctatgaagaactgatgcagctcattcgctcacacaagccggatccttcaata
tcttctaagtcaccattatcatctatctatcaagttttgggatctacagctcatgcagcg
cgacaatacgatggtgcgtgctgttggtttgaaagcctcaaggccaccttaagcccggag
tcggactctgctgtggtattgtgctctgtgtccgcacgcattcttgctactgctctgaaa
aagccaaagttggatgatgacattgaaaaggctattcaagaagtcatcgacagtctggag
ggtagtcttagtggcactctcacagagctcaatgaactgctagaaagcctctcagctacg
aggcgatccgtcgtgggactgttgatgaaagagttggatcctaaggcagtctctgatccg
atacctcagacaacaagcaccctattgaacaactttgttcttcgatacccacgattcttg
agacgatggataggtactgcccctggaaaagatgctcctgcgaagcaaaccttgcagttt
gaccagcgaaaacaagccgtcatgcaatcaataaaccagacactagacgcaaccttaatg
gtagtcaagtgtgggattcaatctggtgctctcgaatggcaccaaattgacgatgtcctt
cagcattgttcgggactgctcgactccatttgcgatccactgctctcccctgcgagagtt
gagcaacttgggggctaccatgttaagatttccactctctatttttccaagttcatggag
ctgcgaaagatgaagcaccgaaccaaggacctcaataaacagctgttacagtctctaagc
agatccatcgacgctgtcaaagagcgatcttcctccctaaaagataaggcgcagttgtca
atgaagctggagctgtttgccgacctatgcaaggggtctggccgaagtgaggatgccgtt
ggaactctcagatccatctgcactaacatggccgaagatggcgttctctctgatgttgct
gctgctctagcatcgttaccacctactcttgcctgggccaccacggataaagcctcttcc
ctatcgcgtactttgcgctcaatagctaagctggataaatcttggaacgactggactttc
ttccttcctgaggctgaacgagcggctgtacttgagcatcttatgcatttaagcactgaa
tcagcaggtcagcgggaacccctccgccttcatgatcctagcccggctgcgctacttcga
atctattctttggataaatatcccatccggcgattccgagtgttacttcacttgctgtat
cagaatattggagaagatgaggagttggcagaaattacatcgaaccttggtcaagtttct
caacagctccagaagagagacaaaggagaagatgggtctctcacacaatttattcctcac
ctccaagcatatcattcttccttggccgccctagccgatagtgataatgagttccctact
tcagtcgtcaagggtaacatcacttgctggaaggcgattcttggatcatatcaatccaag
gatgatttatacaccaagatcgacaacccacagacattgattgactttttgcagacgctc
aaccatttggctgatctacggggagaaacagagcttcaaatttctatttcggaactttcc
attgcaatggccaaagctgtagctgaatactctggatcattcgatgatggtttgattctc
cacagcagccatcttgctattcaatatatcggcattggcaagttttctcaggcatccggt
gcactcgaagtctccaaagagctccttgaacacaatgaaggggtatcgcaacgggttgtc
gccgacttttacttatcacaagctgagtactacgctggtgttggaagtctggacgaagca
ttgatttatgtcaataaagcaaacgacatttgttaccaatcgtactcatcatgggcacag
tccaagtaccaagccaatttgatgatttctttgtcagcccttattcagtccacagtctca
atacaaaccggcaatatcgaagacgctctatcatcgatccgaactggtgttcgtacgttg
tctcacgattgggctaagctcgaagcagcatcgtcagaacccgactcaaatatgtccgga
aaccgcttgattggtcttgacctaaaaacatctcaggtcaaaaggactggccctcggttt
tgggggctcgcagtaccattgctccgctgcctcttacatatatcatctgtgtatgcgcat
attggaatgtttcaggagaccatttactatgccgaatctgcatggaaaatagcgcagagc
acacaatcctctctctactgtgcgcaagtcaccgcgtggaccgggtctatatatcttaag
gcaggaaacataacaaaagctattgaaactttggcggatgcacagcgtcacattcccagc
aatatttgctcctcgcgtgtgcactttgctcgaaagcttggcgagctatattccgaaata
ggggacgaagacaaagctaacgaatatctaacaatggcggaagagactctgcgattgatg
gacaataatcccggtaattctgtttgtattgaaaagtcggctgcgcctatggaaaaggca
aagacaaccgccgcgaaaacctcacggactgcacgaactgccaaagccaagcccgcatct
gttacgcgacctaccaggcgacctgcaacaacaaaggcccaggcaatcacagccgaggcg
gtagctcaactccccaaagatatttaccaatcatcattacttgccgcagttcttctttcc
agggcaattggatacatacaaaagaaggattggtcttccgccttgtcaactttggaccag
gcaaaggaattgccgaagctatttggaactctgtccttggagcagattgtcaccgcaacg
tccctcatcggccatagcatggaacagatgatttcagacccggtcttttctgtaatgcaa
gactctacaatttcgtttcctgccgtagctagcagcgcagggagggcctccatggacaag
aacaaccttgttgcgtcgcccccccgccgtggacgcgctgcagccggtgacaggaagaca
gccaaagacaaatctggaccggcgtttgcagacgccctccgacaggctcaagatatattg
attgaagcacatgcgtctaccttgtcgacatctgatagtggtatggtgcaccggctttca
acattgttacaaagcaccattatcctactgtctgctacatctgcttccaagacgaagccc
gtcctttcatctggcctcgccacagtagcagtggacttgggccgcaacattacgtggaca
cgagagcaaattacccttttgaatacgttacgacccctgggggccagtctgccttctgtt
cccgacgacccgccaacctcgcttcgcaaaactattatgagtctcactccggatatggct
gcgtttcaaaagaattatgtagacttgttgcctaataactggaacgtcatttctctctca
ttgagtgacagttcccgtgatctttctattaccaagttacaggctggacacagtccgttc
attttacgcctaccgctggagagagccaactctcgcgatgctgacgctgaggtgtttaat
tttgaacatggacgtgaggaacttctcgatatcattaaacttgccaacgagaccagtcat
tctgcgcgtgacttttcagcaaagggcgagcgaagcgcttggtgggctgaacgcgaagca
ctggataccagactgaaggacctcttgtcgacggttgaatcgacctggttgggaggattc
aaaggtatcttctctcagcaccaaagaaggacagatttattggcgcgcttccagaaaagt
ttccagcaaatccttgatggaagccttccatctcgaaaccgaatacgtggcaagaagacg
actaaagcatcgtctgttaatcttgatcccagaattctcgaccttttcatcggccttggc
gacccaactcatccggactgcgactttgatgaggctctgaacgacttgctttactttgtc
gtagatattttacagtttcacggggagaggaacgcatacgacgagattgatttcgatgcc
atggttgtcgagacatatgatgcccttcgaggatattactcggccttgaacgcgggctca
gagcgacaggaaggctctcacactatcctcatcttagataaggccctgcatgccttcccg
tgggaatcgctgccttgcatggaagggctggcgctatcccgagttccgtcacttgcctgt
ctacgacaactcattacagaatccaacacgcagggggccgagcccgaactccaagagggg
cattgtgtttctcccaaagctggaacctatatcctcaatccatcctctgatctgaagaac
acacaggctttctttcagtctacattcgagactctcaagagctgggacgggattgtcaac
aaaaccccgcaagaatctgaattcgaagacgctctgtcaaaatcagagattttgctctac
tttggacatggcagtggtgcgcaatacatccgcggcaagacagttcgacggctggagaaa
tgccgggcaactacgtttctcatgggctgcagctcagcggcacttacagaagccggggag
tttgagtgttatggccctgtgtggaactacatgatggcaggttgtcctgcggtggtgggc
acgctttgggatgtgacagatcgtgacattgaccgtttcgcgggccggacttttgaagaa
tggggactgtttgctcgtggcacattcgaaaagggcgataggaagaaaggtagaggtaag
aaaggcggtgtcaacgacgtagacacggacagcggtgatgatgatatcgactcggaagca
ccgtcacgtccaacgtcgccgcgactggcaaggggttcttcgcttcccgaggccgtggct
aaagctcgagacgcttgcaaattcaaatacctgaacgcagctgcggttgttgtttacggt
atccctgtatacatcaatcgtgaaggctga

DBGET integrated database retrieval system