KEGG   Metarhizium robertsii: MAA_03607Help
Entry
MAA_03607         CDS       T03107                                 

Definition
(RefSeq) serine threonine protein kinase
  KO
K08818  cell division cycle 2-like [EC:2.7.11.22]
Organism
maj  Metarhizium robertsii
Brite
KEGG Orthology (KO) [BR:maj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:maj01001]
    MAA_03607
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:maj03041]
    MAA_03607
Enzymes [BR:maj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     MAA_03607
Protein kinases [BR:maj01001]
 Serine/threonine kinases: CMGC group
  CDK family
   MAA_03607
Spliceosome [BR:maj03041]
 Complex A
  Other components
   Complex A specific factors
    MAA_03607
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 19257893
NCBI-ProteinID: XP_007819796
UniProt: E9EUA8
AA seq 471 aa AA seqDB search
MASKGKSRWADTEEDAELDARLKQEKEEKRRKKAEKARRIEADKQTALAASSRGPESSRD
NETDRPSKRRRVTPETGETTTQGSTSSNDPKPIKLLRFEDTGTWGKSRSVDNYDKLNDIE
EGTYGWVARGTERVTGKIVALKRLKLEPSDRNGLPVTGLREIQILQDCKHRNIVHLEEVV
VGEDTSKLDNSIFLVLEFVEHDLKGILEDMPEPFLSSEVKRLLLQLTSGVSYLHENWILH
RDLKTSNLLLNNRGQLKIADFGMARYVGDPPPKLTQLVVTLWYRAPELLLGTRTYDAAVD
MWSVGCIFGELITREPLLQGSNEVDQMSKIFELCGVPTEESWPGFRKLPNARSLKLPKNA
LSNGSVVRARFPSMTTAGASLLNDLLALDPVRRPSAKEMLSHEYFRQDPKPKPESMFPTF
PSKAGQERRRRHEPNAPVRGQAVALGDVDLSGIFQGRDKEERGAGFTLRMV
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaagggcaagtcgagatgggcagatacggaggaggacgccgagttagatgca
aggttaaaacaggaaaaggaagagaagcgtcggaagaaggcggagaaggcgcgtaggatt
gaggcagataaacagacggcccttgccgcatcttcacgaggcccggagtcaagtcgcgac
aacgagactgacagaccgtccaaacgacgcagagtcacgcccgagaccggagagaccacg
acacagggaagcaccagcagcaatgaccccaagcccatcaagctcctgcggttcgaggat
acggggacttggggcaaaagtcgcagtgtcgacaactacgacaagctcaacgatatcgaa
gagggcacatacggctgggtcgcaaggggaacagagcgtgtcactgggaaaatcgtagcg
ctcaagaggttaaagcttgagccctcggatcgaaatggtctgccggtgacggggttgaga
gagatccagatcttgcaggactgtaagcatcgcaacattgtgcacttggaggaggttgtt
gttggcgaggacacttccaagctggacaactccatattcctcgtcctcgagttcgtcgaa
cacgacctcaagggcatcctcgaagacatgcccgagcccttcctctcgtccgaagtcaag
cgtctcctcctacaactcacgtcgggcgtgtcctacctgcacgaaaattggatcctccac
cgtgacctcaaaacatccaatctccttctaaacaaccgcggccagctcaagattgccgac
tttggcatggctcgctacgtcggcgatcctccccccaaactgactcaactcgtcgtgaca
ttgtggtaccgcgccccggaattgctcctggggacaagaacgtacgacgcagcagtcgac
atgtggagcgtgggctgtatattcggcgagctcatcacgcgcgagcccttgctccagggc
tccaacgaagtggaccaaatgtccaagattttcgaactgtgcggcgtgccaaccgaggaa
tcgtggcccgggtttcgcaagctccccaacgcgcggagcttgaagcttcccaagaacgcg
ctgtccaacgggtccgtggtacgcgcgcgatttcccagcatgaccaccgccggggcgagc
ctcttgaacgacttgttggctctggatccggtccggcggccgtcggcaaaggagatgctc
agccacgaatacttccgacaggatcccaaaccgaagcccgagagcatgttcccgacattc
cccagcaaagcaggccaggagcggagacgtcggcatgagccaaatgcgcccgtcagaggg
caagcagtcgctttaggagatgttgacctgagcggcatcttccaggggcgggacaaggag
gagcgtggagctggcttcacactgcgaatggtgtaa

DBGET integrated database retrieval system