KEGG   Metarhizium robertsii: MAA_04213Help
Entry
MAA_04213         CDS       T03107                                 

Definition
(RefSeq) mitochondrial ribosomal protein L44
  KO
K17434  large subunit ribosomal protein L53
Organism
maj  Metarhizium robertsii
Brite
KEGG Orthology (KO) [BR:maj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:maj03011]
    MAA_04213
Ribosome [BR:maj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MAA_04213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MRP_L53 Ecotin KorB_C
Motif
Other DBs
NCBI-GeneID: 19258499
NCBI-ProteinID: XP_007820402
UniProt: E9EW14
AA seq 97 aa AA seqDB search
MITKFVTEITAKFNPFSACAKPARLFLTFLPPNARASGTSITTTLLPRNSTEASSLRVKF
KDGKELNFDCGKMNIKGLVEEVNRHSRQLQKAADLTD
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgattacaaaattcgtgaccgagattacggccaagttcaacccgttttcggcatgcgca
aaacccgcccgactgttcctcacgtttctgcctcctaatgcccgtgccagcggcacgtcg
ataactacaactcttcttcctcgaaattcgaccgaggcaagctcgttaagagtcaagttc
aaggacggcaaggagctcaacttcgactgcggaaagatgaacatcaagggacttgttgaa
gaagtgaaccggcactctcgccagctgcaaaaggcagccgatttaacggattaa

DBGET integrated database retrieval system