KEGG   Metarhizium robertsii: MAA_04629Help
Entry
MAA_04629         CDS       T03107                                 

Definition
(RefSeq) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
maj  Metarhizium robertsii
Pathway
maj01100  Metabolic pathways
Brite
Enzymes [BR:maj01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     MAA_04629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-GeneID: 19258915
NCBI-ProteinID: XP_007820916
UniProt: E9EX80
AA seq 278 aa AA seqDB search
MAKTVIAFDLYGTLLSTESIANELARIYGEDEAKLIATQARRYQLEYTWRINSMDDVAFD
TGDIHSSMLRSTSGDATLFTPRPVTDDQVGLYRSFSELTRHSFRQATAEIGLELSRDQEE
RILDAYNGLDTFPDADKGLALVSQTPSLKPYIFSNGTMAMITSSLKTSPSLAKSGTTFSE
SNIVSVDPLGVFKPDPRTYRHMAEMAGLTHQLDKVWLVSSNPFDAAGAVAAGLRSVWVGR
QGTGWIDGLGGALGVSPTAVVGSVEEAVREIIRLDGLD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaccgtcattgcgtttgatctctacggcacattattgtcgactgagtcgatt
gcaaatgagctggccaggatctatggcgaggatgaggccaaattaatcgccacccaggca
aggcgataccagctcgagtacacctggcgcattaatagcatggacgatgtagcctttgac
actggggatatacattcaagcatgttgcgtagcacaagcggtgatgctacgctgttcacg
ccgcgtccagtaactgacgaccaggtaggcctataccgatcattctccgaattgaccaga
cactcttttcgccaggcaactgcagaaatcggcctagaactttccagggaccaagaggaa
cgcatccttgatgcttataatggactagacacattcccagatgcagacaagggtctcgcg
cttgtgtcgcaaacgccttctcttaaaccgtatatattttccaacggaacaatggcgatg
attacttcttcgctcaagacctcgccgtcgctggccaagtcgggaacgacattctcggag
tctaatattgtcagtgtcgatcccctcggcgtgttcaaaccagatcctcggacgtataga
cacatggctgagatggctggtttgacacatcagttggacaaggtctggcttgtgagttcg
aatccctttgatgctgcgggtgctgttgccgccggactgaggagcgtttgggtaggccga
cagggaactgggtggattgatggactgggcggtgcgcttggtgtcagtccaacggcagtc
gttgggagtgtcgaagaggctgtgagagagattatcaggttggacggtttggattag

DBGET integrated database retrieval system