KEGG   Metarhizium robertsii: MAA_06099
Entry
MAA_06099         CDS       T03107                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
maj  Metarhizium robertsii
Pathway
maj00100  Steroid biosynthesis
maj01100  Metabolic pathways
maj01110  Biosynthesis of secondary metabolites
Module
maj_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    MAA_06099
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     MAA_06099
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19260385
NCBI-ProteinID: XP_007822288
UniProt: E9F1F0
AA seq 489 aa
MSSSKTAAKSAPPAKHGYEFFGPPGAFGISFGLPILVYVFTFVCNDISGCPAPSLLGPRP
LSLEQLKIEVGWPQNGIWGLASWEATGAVLAYYLLNLILYRVLPATEVDGTVLSSGGRLK
YRFNTFYSNTVTLAALAAGTVAQGAEFPVWVFISENYLQILTANIGISYAIATFVYVRSF
SVKPGNTQFRELAAGGCTGNLLYDWFIGRELNPRVTIPLIGEVDLKEWCELRPGMMGWII
LNCAWCAQQYRNFGFVTDSIICITIVQALYIIDSWWFEPAILTTMDITTDGFGMMLAFGD
LVWVPFVYSMQTRYLSVHPLSLGPAGLAGTLSLIGLGFYIFRSANSQKNTFRTNPNDPSV
AHLKYIETNTGSKLLITGWWGIARHINYLGDWIQSWPYSLPTGLAGYQILAAGAGAAGQG
AYIMKDGREVIQGNARGWAIPITYFYIVYFAVLLIHRERRDDEKCHRKYGEDWDKYKKIV
RWRIIPGIY
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtcctcatcaaaaactgcggccaagtctgcacctccggctaagcacggatacgagttc
ttcggcccccccggcgcctttggcatctcgtttggtctacccatcctcgtctacgtcttc
actttcgtgtgcaacgacatatccggatgccctgcgccatcgctgctaggtccgcgcccc
ttgtcactagagcagttgaagattgaagtcggttggccacagaatggaatatggggtctc
gccagctgggaagcgaccggtgcagttcttgcctactacttgctgaacctcattttatac
cgcgttttgcctgcgaccgaggtagacgggaccgtcttgagctctggcggccgtctcaag
taccggttcaacacgttctactccaacacggttactttggcagccctcgcagccggaact
gttgctcaaggcgccgaatttcccgtttgggtctttatcagcgagaactatctccagatt
ctgacggcaaatatcggcatttcttatgcaatcgccacttttgtgtacgtccgcagcttc
agcgtcaaacctggaaacacgcaatttcgcgagcttgcagccggcggctgcactggcaac
ctgctctatgactggttcattggccgcgagctcaaccctcgcgtcacaatacccttgatt
ggagaagttgacctcaaggagtggtgcgagctgagacctggcatgatgggctggatcatc
cttaactgcgcttggtgtgctcagcagtaccgcaactttggcttcgtcaccgacagcatc
atctgcatcacgattgtgcaagccctatacataatagattcatggtggttcgagcctgct
attctaacaaccatggacatcacaactgacggttttggcatgatgcttgcctttggcgac
cttgtctgggtgccctttgtctactccatgcaaactcgatacctctccgtgcaccctctg
tcgcttggtcccgccggcctcgcaggtaccctttccctcattggccttggcttctacatc
ttccgctccgccaacagccagaagaacactttccgcacaaaccccaatgaccccagtgtc
gctcacctgaagtacattgagaccaacacgggcagcaagcttctaatcacaggctggtgg
ggaatcgctcgtcacatcaactatcttggcgattggatccagtcttggccatacagtctc
cccaccggacttgctggctaccagattctggctgctggtgcaggcgccgccggtcagggc
gcgtacatcatgaaggacggccgtgaggttattcagggcaatgcgcgaggctgggctatc
cccattacctacttctacattgtatactttgccgtgctgcttattcatcgtgagcgtcgc
gacgacgagaagtgccatcgcaagtacggtgaggactgggataaatacaagaagattgtg
cgttggagaatcatccctggtatttactag

DBGET integrated database retrieval system