KEGG   Metarhizium robertsii: MAA_06435Help
Entry
MAA_06435         CDS       T03107                                 

Definition
(RefSeq) N2,N2-dimethylguanosine tRNA methyltransferase
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
maj  Metarhizium robertsii
Brite
KEGG Orthology (KO) [BR:maj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:maj03016]
    MAA_06435
Enzymes [BR:maj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     MAA_06435
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     MAA_06435
Transfer RNA biogenesis [BR:maj03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    MAA_06435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRM CPSF100_C
Motif
Other DBs
NCBI-GeneID: 19260721
NCBI-ProteinID: XP_007822624
UniProt: E9F2N7
AA seq 642 aa AA seqDB search
MAEEAPPVQIIERDGKQFKTITEGKATILVPHETKAGQDTTEEQQVFYNPIQQYNRDLST
LVVKVYGEMLLEKRVEAFNSKNVKQGKKRKRDEIEQDNEEATTQATEQQQLEKEKAENGH
TYKPSFKILDALSASGLRALRYALEIPFVTSVTANDLSASAAESIAVNADHNGVAGKFTV
TNDDALALMYRSIASDLSRRDKRGNPGKSHKFDVIDLDPYGTAAPFFDAAVQSVRDDGGL
LVITCTDSAVWAGHSYCEKTFSLYGGVPVKGMHSHEAALRLILNAVATSAARYGIAIEPM
LSLSIDFYTKVFIRVTKSPSAVKFLGAKTMLVYSCDQGCGSWETQPILKSRPFPNKKGSG
SFYKHTMAQGPSTDRLCQHCGFKMHISGPMYGGRIHNQDFIHRMLDEIPKASPETYGTLS
RVEGMLRTALEEYIPGPELPTDVDPKDAEAAVVDHTPFFFIPGKVSSILSCSTPTDDMFR
GALMHLGYQAGRSHCRPGSIKTDAPWSTIWWILTEWIRQKSPVKVSKFKESMPGWKILYD
AGIVGHENAKSDDSQGPESIDTKMEGTEQQQQQQQNDEKVLERTEAEGNAGEKKEPLTED
ELRKTLVFDDALIQLGRQKGTRYMRYQVNPHKYWGPMTRAKG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagaagcgcccccagtgcagatcattgagcgggacggtaagcagttcaagacc
attacagagggaaaagctacgattctggttccccatgaaacgaaagccggccaagacacg
actgaggaacagcaagtcttctacaatccaatacagcagtacaatcgcgacttgtcgacg
ctggtagtcaaggtgtatggggagatgctattggaaaagcgagttgaagctttcaactca
aaaaatgtaaaacaaggcaagaagcgaaagcgagatgagatagaacaagacaacgaagaa
gcaaccacacaagccacggagcagcagcaactagagaaagaaaaggcggaaaatggccac
acatacaagccttcattcaagatccttgacgccttatcagcatcgggcttgagagctttg
agatatgccttggaaattccttttgttacatctgttaccgccaatgacctgtctgcctct
gctgcggaatcaatagcagtcaatgccgaccacaatggtgtagcgggtaaatttaccgtc
actaatgatgacgccctagccctaatgtaccggtctattgcgtcggatctttcgagaaga
gataaacgcggcaaccctggcaaatcacacaagttcgatgtcatcgacctcgacccgtat
ggaacagctgctccgttttttgacgccgctgtccagtctgttcgtgatgatggtggccta
cttgtcatcacctgtacagacagtgccgtctgggccggccacagctattgcgaaaaaacc
ttttccttgtatggcggtgtccctgtcaaaggaatgcactcccacgaggcagccttgcgc
cttatcctgaacgccgtcgcaacttctgcagcgcgatacggtatcgcaattgagcccatg
ctgtcgctatcgattgatttctatacaaaggtctttatcagagtcacgaaatcaccgtcg
gcggtcaagtttttgggagcgaaaacgatgttggtgtatagttgcgaccaaggctgcggt
tcttgggagacacaaccaatcctcaagagccggccattccccaataaaaagggaagcgga
tccttctacaagcacacaatggctcaaggcccgagtactgatcgcctttgccagcattgc
ggcttcaagatgcatatcagcggacccatgtatggcggtaggatccataaccaggacttt
attcaccgtatgctcgacgaaatacccaaggcatctccggagacatatggaactttgtct
cgtgtggagggtatgttgcggactgccttggaggaatacataccgggacctgaactgccc
acggatgtcgaccctaaagacgcagaagctgcggtcgttgaccacaccccattcttcttt
atccctggaaaggtctcgagcattttatcgtgttccaccccgactgatgacatgtttcga
ggcgcactcatgcatctgggctatcaagcgggcagaagccactgccgcccaggcagcatc
aagactgacgcgccatggtcaactatttggtggattttgacagagtggatcaggcaaaag
tcaccagtaaaagtgtccaaattcaaggagtccatgcctggatggaagattctttatgac
gctggaattgttggacacgaaaatgcgaagtcggacgatagccaagggccggagagcatc
gacaccaagatggaaggcaccgaacagcagcagcagcagcagcaaaatgacgagaaggtg
ctagaaaggactgaagcagagggcaatgccggggaaaagaaagagccgctgactgaagac
gagttgcgaaagacgctcgtatttgatgacgctttgatacagcttggtcgtcagaaaggc
actcggtacatgaggtaccaggtcaaccctcacaagtattggggccccatgacaagagcc
aagggttga

DBGET integrated database retrieval system