KEGG   Metarhizium robertsii: MAA_08207Help
Entry
MAA_08207         CDS       T03107                                 

Definition
(RefSeq) Cytochrome P450 CYP55A19
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
maj  Metarhizium robertsii
Pathway
maj00910  Nitrogen metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAA_08207
Enzymes [BR:maj01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     MAA_08207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 19262493
NCBI-ProteinID: XP_007824396
UniProt: E9F7F8
AA seq 348 aa AA seqDB search
MSVEPPRFPFQRASGMEPPAEYARLRATEPVSRVTLFDGSLAWLVTKYKDVTQVATDNRL
SKVRDRPGFPELSAGGKAAAKAKPTFVDMDPPDHMHQRQVPFIQKTVDDLLAAMKAKGCA
AAPVDLVKEFALPVPSYIIYTILGVPFSDLEYLTQQVATRSNGSGTAREASTVSQTDGVT
CRELLNYIGTLVDKRLAEPKNDLISELVVNQIAFLLLVAGNATLVNMINLGIVTLFQHPD
QLDQLKSDPSRAGAFVKELCRYHTASALAMKRTAKVDVEIGGQRIKAGEGIIASNQSANR
DADIFTDPDTFDMNRTWPAEDPLGFGFGDHRCIAETLAVAELTTVFGT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtggaaccccccagattcccgttccagcgtgcctcgggcatggaaccgcctgca
gagtacgctcgtctgcgagccacagagcctgtctcacgggttacgttgttcgacggcagc
ttggcctggcttgtcaccaaatacaaagatgtcacacaagtcgcaactgacaacaggctg
tccaaggtacgtgacaggcctggcttcccagagttgagtgccggaggcaaggctgctgcc
aaggccaagccaacctttgtcgacatggatccgcccgaccacatgcaccaaaggcaagtt
ccctttatccagaaaacagtcgacgacctcctggccgctatgaaggcgaagggttgcgcc
gccgcacccgtcgacttggtcaaggaatttgcactgccggtcccctcctatatcatttac
accatcctcggcgtgccattcagcgacctggaatatctcacacagcaagttgccacccga
tcaaatggcagcggaacagccagagaggcttcaacggtgagccaaactgacggtgtgaca
tgcagggaactgctgaattacattggcacccttgtcgacaagcgcctcgctgagccgaag
aatgatctcatcagcgaactggttgtcaaccagattgccttcctcctgcttgtcgcgggc
aacgcaacgctagtcaacatgatcaacctgggcatcgtgacgctattccagcacccggat
cagttagatcaactgaaatcagatccgtcccgggcaggcgcctttgtcaaggagctttgc
cgctaccacaccgcatcggcactggcaatgaagcgaacggcaaaggttgacgtcgaaatc
gggggacagcgtattaaagccggagaaggcatcatcgcgtccaaccagtcggcgaatcgg
gacgccgacatctttaccgaccccgacacattcgatatgaaccgtacgtggcctgccgag
gaccctctagggtttggttttggcgaccaccgatgcatcgcggagaccttggcggtggca
gagctcaccactgtgtttggtacgtag

DBGET integrated database retrieval system