KEGG   Metarhizium robertsii: MAA_08635Help
Entry
MAA_08635         CDS       T03107                                 

Definition
(RefSeq) general amidase-B
  KO
K01426  amidase [EC:3.5.1.4]
Organism
maj  Metarhizium robertsii
Pathway
maj00330  Arginine and proline metabolism
maj00360  Phenylalanine metabolism
maj00380  Tryptophan metabolism
maj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MAA_08635
   00360 Phenylalanine metabolism
    MAA_08635
   00380 Tryptophan metabolism
    MAA_08635
Enzymes [BR:maj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     MAA_08635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 19262921
NCBI-ProteinID: XP_007824824
UniProt: E9F8N6
AA seq 564 aa AA seqDB search
MASLLSNQALPWGQRVSAKRQACYYALPASWLLDQKLLESLETPWERCRNNMVELNAFRE
SGILSERELRITEQYNVAELLGLISSGEITALEATLAFSKRAAIAQQLTNCLTETYFPQA
QQRAKQLDLLRENGETVGPLHGLPISLKDTFQIKGSEATIGMVAFLDQASTTNSCLVDIL
NDLGAVLYCKTNVPQTLMTADSDNNVFGRTLNPWNTALTAGGSSGGEGALIAMRGAAIGV
GTDVAGSIRIPALCCGTYGFRPTTGRIPYGKQRGCANPGFRPIPPCAGPLSNDIDSLPIF
MKAVLSANPRRYDATATDVPWREIQGSSARKLRLGLVPEDPRIPLHPPVQAALKEAVHLL
EKQGHEIVKLSPEECRVDQACQVSWSLLGLDDMPNRRVLEAGETAVPSRLRFQQAISKMG
MEHVADIHGLDPLQKYAALTVKRASIADDWNQLWVSKRLDAVVAPAAQNSAVEHDEFNVP
AYTVFLNLLDYPACVIPFGKVAGIEVNFKVGSGQSTPQYNPKALEGAPLSIQVFTSSMRD
EECLDVAKVVDECLRQGDSHKARF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcttccttattatctaaccaggcactcccttggggacaaagggtttctgcgaagcgt
caagcctgttattacgccctgccagcttcatggctattagaccaaaagcttttggagtct
ctagagacaccatgggagagatgcaggaataatatggtagaactaaatgcctttcgagaa
tccggcatactttctgaacgcgagctgcgaattaccgagcaatataatgtggctgaactt
cttggactcatatcgtcaggtgaaattactgctttggaagccactctagcattttcaaag
cgtgcggcaatagcacagcagttgacgaactgtctaaccgagacatactttccacaagcg
cagcagagggcaaagcagctcgacttactaagagaaaacggcgaaaccgtcggcccatta
catggactcccgataagtctaaaagatacctttcaaataaagggcagtgaggcaactatt
ggtatggttgcattcttggaccaagcctcgacgactaattcatgcctggtggatatctta
aacgacttgggagccgtgttgtattgcaaaactaatgtccctcagacattaatgaccgca
gattcagataacaatgtgtttggacgaaccttaaacccctggaacacagcattgactgct
ggtggttctagtggtggtgagggcgctctcattgcgatgcgcggagccgcaattggcgtt
ggtacagatgttgccggctctattagaatcccagccctatgttgtggcacatatggcttc
cgcccgacgactggccgcatcccgtacggcaagcaaagaggctgcgcaaacccggggttt
cgtccaatacccccatgcgccggacctctcagcaacgatattgattctctccccatcttt
atgaaagccgtgttatctgcgaaccccagacgatacgatgctaccgctaccgacgttccg
tggcgtgagattcaaggttcgagtgcgcgaaagttacgtctaggtctggtccctgaggac
ccaagaattccactccacccaccagtccaggcagcactaaaagaggcagtccacctacta
gagaaacaaggccacgagattgtgaaacttagtccggaggagtgccgcgtggaccaagcc
tgccaagtttcgtggagtcttttgggacttgatgatatgcccaatcgtcgtgttctcgaa
gccggcgagacggctgtcccatcaaggctgcggtttcaacaggcgattagcaaaatgggc
atggaacatgtcgctgacattcacgggctagaccccttgcagaaatacgctgcattgacg
gtaaagcgggccagcattgccgatgactggaaccagctctgggtgagcaagcgactcgat
gccgttgtagcaccggccgctcagaactccgccgttgagcatgatgagttcaacgtgcct
gcgtatacggtattcctcaaccttttagattatcctgcatgcgtgattccatttggaaaa
gttgccggaatcgaggtgaacttcaaggtcggatcgggtcaatcaacaccacagtataac
ccaaaggctctggaaggagcaccactgtccattcaggtgtttacgtcgtcgatgcgtgat
gaggagtgtcttgatgtcgcaaaagtggttgatgagtgtttgcgccagggtgatagccac
aaagctcgattctag

DBGET integrated database retrieval system