KEGG   Mycobacteroides abscessus subsp. bolletii MM1513: LH56_17110Help
Entry
LH56_17110        CDS       T03341                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mak  Mycobacteroides abscessus subsp. bolletii MM1513
Pathway
mak00071  Fatty acid degradation
mak00072  Synthesis and degradation of ketone bodies
mak00280  Valine, leucine and isoleucine degradation
mak00310  Lysine degradation
mak00362  Benzoate degradation
mak00380  Tryptophan metabolism
mak00620  Pyruvate metabolism
mak00630  Glyoxylate and dicarboxylate metabolism
mak00640  Propanoate metabolism
mak00650  Butanoate metabolism
mak00900  Terpenoid backbone biosynthesis
mak01100  Metabolic pathways
mak01110  Biosynthesis of secondary metabolites
mak01120  Microbial metabolism in diverse environments
mak01130  Biosynthesis of antibiotics
mak01200  Carbon metabolism
mak01212  Fatty acid metabolism
mak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH56_17110
   00630 Glyoxylate and dicarboxylate metabolism
    LH56_17110
   00640 Propanoate metabolism
    LH56_17110
   00650 Butanoate metabolism
    LH56_17110
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH56_17110
   00072 Synthesis and degradation of ketone bodies
    LH56_17110
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH56_17110
   00310 Lysine degradation
    LH56_17110
   00380 Tryptophan metabolism
    LH56_17110
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH56_17110
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH56_17110
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LH56_17110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mak04147]
    LH56_17110
Enzymes [BR:mak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH56_17110
Exosome [BR:mak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH56_17110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin
Motif
Other DBs
NCBI-ProteinID: AIR44291
Position
3459216..3460433
Genome map
AA seq 405 aa AA seqDB search
MPEAVIVSTARSPIGRAGKGSLVSMRPDDLAAQMVRAALDKVPALDPKDVDDLMLGCGQP
GGEAGFNIGRAVAVQLGYDFMPGTTVNRYCSSSLQTTRMAFHAIKAGEGHAFISAGVETV
SHFPKGTSDGWPDSHNPLYADAEARTATAAQGATEWHDPRNDGLTPDVYIAMGQTAENVA
LHTGISREDQDHWGVRSQNRAEKAIADGFFEREITPVTLADGTVVAKDDGPRAGTTYEAI
SQLKPVFRPNGTITAGNACPLNDGAAALVVMSDVRAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEAVKRALANAGKSIGDIDLFEINEAFAVQVLGSARALGIDEDKLNVSGGAIALGH
PFGMTGARITATLLNNLTTYDKTFGVETMCVGGGQGMAMVIERLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagccgtgatcgtttccactgcccgctccccgatcgggcgagccggcaagggc
tcgctggtgagcatgcggccggatgacctggccgcgcagatggtgcgcgccgccctcgac
aaggtgcccgcactggaccccaaggatgtcgacgacctgatgctgggctgcggtcagcca
ggcggcgaggccggtttcaacatcggtcgcgcggtggcagtacagctgggctacgacttc
atgcccggcaccaccgtcaaccgttactgctcgtcgtcgctgcagaccacccgcatggcg
ttccacgccatcaaggccggcgagggtcacgcattcatttccgctggtgtggagacagtt
tcacactttccgaagggcacttcggacggctggccggacagtcacaacccgctgtacgcc
gacgccgaggcccgcaccgcgaccgcggcacagggtgccaccgaatggcacgacccgcgc
aacgacggcctgactcccgacgtgtacatcgcgatgggccagaccgccgagaacgtggca
ctgcacaccggcatcagccgtgaggaccaggaccactggggcgtgcgcagccagaaccgg
gccgaaaaggctattgccgatggctttttcgagcgcgagatcaccccggtgacgctggcc
gacggtaccgtcgtcgccaaggacgacggcccccgtgccggtaccacctacgaggccatc
agccagctgaagccggtgttccgccccaacggcaccatcaccgccggtaacgcctgcccg
ctgaacgacggtgcggccgcgctggtcgtgatgagcgatgtgcgcgccaaggagctgggc
ctgaccccgctggcgcgcatcgtctccaccggtgtgtccggcctgtcgccggaaatcatg
ggcctgggcccgatcgaggccgtcaagcgcgcattggccaacgcgggcaagtcgattggc
gacatcgatctgttcgagatcaacgaggcgttcgccgtccaggtgctgggctcggcgcgc
gcgctcggtatcgatgaggacaagctgaacgtctccggcggtgcgatcgcactgggccac
ccgttcggcatgaccggcgcccgcatcaccgccaccctgctgaacaacctgaccacctac
gacaagaccttcggtgtcgagaccatgtgtgtcggtggcggccagggtatggcgatggtc
atcgagcggctcgcctag

DBGET integrated database retrieval system