KEGG   Monopterus albus (swamp eel): 109951141Help
Entry
109951141         CDS       T05607                                 

Gene name
ppil2
Definition
(RefSeq) LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase-like 2
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109951141 (ppil2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:malb03041]
    109951141 (ppil2)
   03110 Chaperones and folding catalysts [BR:malb03110]
    109951141 (ppil2)
   04121 Ubiquitin system [BR:malb04121]
    109951141 (ppil2)
Enzymes [BR:malb01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     109951141 (ppil2)
Spliceosome [BR:malb03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    109951141 (ppil2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    109951141 (ppil2)
Chaperones and folding catalysts [BR:malb03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    109951141 (ppil2)
Ubiquitin system [BR:malb04121]
 Ubiquitin ligases (E3)
  U-box type E3
   109951141 (ppil2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 zf-NOSIP
Motif
Other DBs
NCBI-GeneID: 109951141
NCBI-ProteinID: XP_020441102
Position
Unknown
AA seq 528 aa AA seqDB search
MGKRQHQKDKMYITCTEYTNFYGGKRAEIPQANFRRLPFDHCSLSLQPFEYPVCTEEGVI
FDLLSIMPWIKKYGTNPISGEKLEAKSLIKLNFAKNNDGKYHCPVLYNVFTNNSHIVANK
VTGNVFSYEAVEQLNIKTKSFKDLLSDEPFTRRDIITLQDPTHLDKFNVSSFFHVKNNLK
VLDPDEEKAKQDPAYHLKSTNLETRETLAELYKDYKGDQLLASTMKEPEAKKTDKINAAH
YSTGRVSASFTSTAMTPATTHEADAIADDTVRYQYVKKKGYVRLHTNKGDLNLELHCDKV
PKAGENFIRLCKKGYYDGTIFHRSIRNFMIQGGDPTGTGTGGESFWGKPFKDEFRPNLSH
TGRGVLSMANSGPNTNKSQFFITFRSCTYLDKKHTVFGRVVGGFETLTAMEKVESDPKTD
KPKSEIKLMSTTVFVDPYEEADAQITAEREQELQKQEEERQQVCTALKKAKEEQAPKTFK
EGVGKYINPATVTRTKRPAXDERGPSPSGAAAAKKSKSKTNFGDFSSW
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcgacagcaccaaaaagacaaaatgtacataacgtgtacagagtacacaaac
ttttatggggggaagcgagcagaaatcccacaggcaaacttcagacggcttccttttgac
cactgcagcttgtcacttcaaccatttgagtatcctgtctgtactgaggagggagtcatc
tttgacctgctgagcattatgccatggatcaagaagtatggtactaatccgatctctgga
gagaaactggaagcaaaatccctcatcaagcttaactttgccaagaacaacgatggaaag
tatcactgccctgttctgtacaatgtcttcacaaataattctcacattgttgccaacaag
gtcactggcaatgtgttttcttatgaggctgttgagcaactcaacatcaagaccaaaagt
tttaaagatctgctgagtgacgaaccctttaccagaagagacattataacccttcaggac
cccacacacctggacaaatttaatgtttccagcttcttccacgtgaagaacaacctgaag
gtgttggatccagatgaggaaaaggccaagcaggacccggcgtaccacctgaagagcacc
aatcttgagaccagggagaccttagctgagctgtacaaagactacaaaggggatcagctc
ctcgcttccaccatgaaggagccagaggccaagaagacagacaagataaatgctgcccac
tactccacaggcagagtttcagcctccttcacgtccacagccatgaccccagcaacaacg
cacgaagcagatgccatcgcagacgacactgtgcgttaccagtatgtcaagaagaaaggc
tacgttcgtctacacacaaacaaaggagaccttaatcttgagttgcactgtgataaggtt
cccaaagctggagagaacttcatccgtctgtgtaaaaaaggctactatgatgggaccatt
ttccacaggtccatccggaattttatgattcaaggaggggaccccactggaactggaaca
ggaggggaatccttctggggaaaacctttcaaggatgagtttcggcccaacctgtctcac
accggccggggggtgctaagcatggcgaactctggtccaaacaccaacaagtcccagttt
ttcatcacattcaggtcatgcacttacctcgacaagaagcacacagtatttggaagggtt
gttggtggatttgagacacttactgccatggagaaggtggagagtgatcccaaaacggac
aaacccaagtcggagatcaagctcatgagtacaactgtgtttgtggatccgtatgaagaa
gctgatgctcagatcacggcagagcgagaacaggagctgcagaagcaggaggaggagagg
cagcaggtctgcactgccctgaagaaagctaaggaggaacaggccccaaagaccttcaag
gaaggtgtggggaaatacatcaatcctgccacagtaaccagaacaaaacgtccggctnng
gacgaaaggggcccgtctcccagcggcgcagcggcagccaagaagtccaaaagcaagacc
aactttggagacttcagctcctggtag

DBGET integrated database retrieval system