KEGG   Monopterus albus (swamp eel): 109951143Help
Entry
109951143         CDS       T05607                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04012  ErbB signaling pathway
malb04068  FoxO signaling pathway
malb04114  Oocyte meiosis
malb04140  Autophagy - animal
malb04150  mTOR signaling pathway
malb04210  Apoptosis
malb04218  Cellular senescence
malb04261  Adrenergic signaling in cardiomyocytes
malb04270  Vascular smooth muscle contraction
malb04350  TGF-beta signaling pathway
malb04370  VEGF signaling pathway
malb04371  Apelin signaling pathway
malb04510  Focal adhesion
malb04520  Adherens junction
malb04540  Gap junction
malb04620  Toll-like receptor signaling pathway
malb04621  NOD-like receptor signaling pathway
malb04625  C-type lectin receptor signaling pathway
malb04810  Regulation of actin cytoskeleton
malb04910  Insulin signaling pathway
malb04912  GnRH signaling pathway
malb04914  Progesterone-mediated oocyte maturation
malb04916  Melanogenesis
malb04933  AGE-RAGE signaling pathway in diabetic complications
malb05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109951143 (mapk1)
   04012 ErbB signaling pathway
    109951143 (mapk1)
   04350 TGF-beta signaling pathway
    109951143 (mapk1)
   04370 VEGF signaling pathway
    109951143 (mapk1)
   04371 Apelin signaling pathway
    109951143 (mapk1)
   04068 FoxO signaling pathway
    109951143 (mapk1)
   04150 mTOR signaling pathway
    109951143 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109951143 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109951143 (mapk1)
   04210 Apoptosis
    109951143 (mapk1)
   04218 Cellular senescence
    109951143 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109951143 (mapk1)
   04520 Adherens junction
    109951143 (mapk1)
   04540 Gap junction
    109951143 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109951143 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109951143 (mapk1)
   04621 NOD-like receptor signaling pathway
    109951143 (mapk1)
   04625 C-type lectin receptor signaling pathway
    109951143 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109951143 (mapk1)
   04912 GnRH signaling pathway
    109951143 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    109951143 (mapk1)
   04916 Melanogenesis
    109951143 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109951143 (mapk1)
   04270 Vascular smooth muscle contraction
    109951143 (mapk1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109951143 (mapk1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109951143 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109951143 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109951143 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109951143 (mapk1)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109951143 (mapk1)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109951143 (mapk1)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109951143 (mapk1)
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109951143 (mapk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 109951143
NCBI-ProteinID: XP_020441106
Position
Unknown
AA seq 369 aa AA seqDB search
MATAAVSAPAGCGPSPGPGTELVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKIRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGFRS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgcggtgtctgcccctgctggctgcggccccagccccgggccgggaacg
gagctcgtccgcgggcaggctttcgacgtcgggcctcgatacagcaacctctcgtacatc
ggggagggagcctacgggatggtgtgctctgcctatgaccgggacaacaagatacgtgtg
gccataaaaaagatcagcccttttgagcaccagacgtactgtcaacgcaccctgagagag
atcaaaatccttctgcgcttcaaacacgagaacatcatcggtatcaatgacattatccgc
acaccaaccattgaccagatgaaggatgtatatattgtccaggatctcatggagacagac
ctgtacaaactcctgaagactcaacatctgagcaacgaccacatctgctacttcctctac
cagatcctacgagggcttaagtacatccactcagccaacgtcctgcaccgcgacctgaag
ccctccaaccttctgctcaacaccacctgtgacctcaagatctgtgactttggtttggct
cgtgtggctgaccctgaccacgatcacactgggttcctaacagagtatgtggccactcgt
tggtatcgagcacctgagattatgctcaactccaagggctataccaagtccatagacatc
tggtcagtgggttgcatcctggctgagatgttgtcaaacaggccaatctttcctgggaag
cactacttggatcagctcaaccacattttggggatcctgggttcaccctctcaggaggat
ctcaactgcatcatcaacattaaagccagaaactatctcttgtcactccctttgcgctgc
aaagtgccatggaaccgcctcttccccaatgctgatccaaaagctctggacctgttagac
aagatgttgacctttaaccctcacaagaggatcgaggtggaggaggctctggcgcacccc
tacctggaacaatattacgaccctacagatgagcctgttgctgaggccccattcaagttt
gacatggagctggatgacctacccaaagagacactgaaggagctcatctttgaagaaact
gcacgtttccagcccggcttcaggtcctaa

DBGET integrated database retrieval system