KEGG   Monopterus albus (swamp eel): 109952425Help
Entry
109952425         CDS       T05607                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04010  MAPK signaling pathway
malb04060  Cytokine-cytokine receptor interaction
malb04068  FoxO signaling pathway
malb04210  Apoptosis
malb04217  Necroptosis
malb05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109952425
   04068 FoxO signaling pathway
    109952425
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109952425
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109952425
   04217 Necroptosis
    109952425
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109952425
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109952425
   04052 Cytokines and growth factors [BR:malb04052]
    109952425
   04090 CD molecules [BR:malb04090]
    109952425
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109952425
Cytokines and growth factors [BR:malb04052]
 Cytokines
  Tumor necrosis fators
   109952425
CD molecules [BR:malb04090]
 Proteins
  109952425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF Ly49 PhoR
Motif
Other DBs
NCBI-GeneID: 109952425
NCBI-ProteinID: XP_020443152
Position
Unknown
AA seq 309 aa AA seqDB search
MCGTALWVLTCLFNTEVLRHKYTPSLCRGNRYAHSLSHCGTCTMSYDQSYPFPQVFLVDE
GGGPQMSSQPPNLVPCWSFPPAQERMRKREKNWMGVSPSVALIVLLLFLLVFAALGFEAY
QIHNMQKQLRDMRQDKPETEFSAMQKQISLSERGLNEEDNRPAAHVIGRIETMPFPPTIK
TLRWEPSAGRAFVSGGVTYKAEDGALQVNETGLYHIYSRVELILKNCNPTSEFVHWVFVR
RTGQTSPLPLMEAHRAGFCTQQPGHSWTTESYLGSALKLRKFDRVFVNVSHPNFLSHTHY
ANFFGLYKI
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggacggccttgtgggtgttaacttgcttatttaatacagaggtgctcagacat
aagtacacaccttctttgtgcagaggcaacagatacgcacacagtttgtctcactgtggg
acctgcaccatgagctacgaccagagctatccattcccacaggtgttccttgttgatgaa
ggtgggggtccacagatgtcctcccagcccccgaatcttgtaccatgctggtccttccca
cctgcccaggagaggatgaggaagcgtgagaagaactggatgggagtcagccccagtgtg
gccctgatcgtgctgttgctgttcctgcttgtgtttgcagccctgggctttgaagcctac
cagattcacaacatgcaaaaacagctgagagatatgagacaggacaaacctgagacagag
ttttctgcaatgcagaagcaaattagtctctctgaacgtgggttgaatgaagaagacaac
agacctgcagcacatgtgatagggcggatcgaaacaatgccgtttcctccgactattaag
actttgcgttgggagccaagtgcagggcgggcatttgtatctggaggagtgacttacaag
gctgaggatggcgctctgcaggtcaacgagaccggactctaccacatttactcacgggtg
gagttgatcttgaaaaactgtaacccaacatctgagtttgtgcactgggtgtttgtgagg
agaacgggacagacctcaccactgcccctgatggaggcccacagagcaggtttctgcacc
cagcagccagggcactcctggaccacagagagttatctcggctctgccctgaaactgcgg
aagtttgacagagtctttgtgaatgtatcacaccccaactttcttagtcatacacattat
gctaacttctttggtctctacaagatctaa

DBGET integrated database retrieval system