KEGG   Monopterus albus (swamp eel): 109952657Help
Entry
109952657         CDS       T05607                                 

Definition
(RefSeq) aconitate hydratase, mitochondrial-like
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00020  Citrate cycle (TCA cycle)
malb00630  Glyoxylate and dicarboxylate metabolism
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb01210  2-Oxocarboxylic acid metabolism
malb01230  Biosynthesis of amino acids
Module
malb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109952657
   00630 Glyoxylate and dicarboxylate metabolism
    109952657
Enzymes [BR:malb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     109952657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 109952657
NCBI-ProteinID: XP_020443496
Position
Unknown
AA seq 781 aa AA seqDB search
MASYCLTVTRLQLALGTGARRFHVSAAFSAKAKVAMSHFEPSSSINYEKMHENINTVRRR
LNRPLTLSEKIVYGHLDNPAGQEIDRGRTYLRLRPDRVAMQDATAQMAMLQFISSGLPRV
AVPSTIHCDHLIEAQIGGTQDLQKAKEVNQEVYNFLATAAAKYGVGFWKPGSGIIHQIIL
ENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPNVIGVRLTGTL
SGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFP
YNHRMRTYLEKTGRGEIASVANQFKDDLVPDKGCEYDQVIEINLSELKPHINGPFTPDLA
HLVSEIGAIAKKSGWPLEVKVGLIGSCTNSSYEDMGRAASLAKQALNKGLKCKAQFTVTP
GSEQIRATIERDGYSKTLSDVGGVMLANACGPCIGQWDRKDVKKGEKNTIVTSFNRNFTA
RNDANPATHAFVTSPEIVTALALAGTLDFNPETDYLTAPNGEKFKLEPPTGDELPSRDFD
PGQDTYQHPPAEGSSVQVDVNPSSNRLQLLEPFDKWHGKDLEDMRVLIKVKGKCTTDHIS
AAGPWLKFRGHLDNISNNLLIGAVNIENDAVNKVKNQLTGEYEGVPDVARHYKASGVNWV
VVGDENYGEGSSREHAALEPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFADPRDYERI
RPDDKISITGLKSFAPGKPLTAVIRHSDGSQETISLNHTFNETQIEWFKAGSALNRMKEL
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggcatcttactgtttgactgttactaggctgcagctggcccttggaactggggcaaga
cgatttcatgtgtctgcagccttcagcgccaaggccaaggtggccatgagccactttgag
cccagctccagcattaactatgagaagatgcatgagaacatcaacactgtacgcaggagg
ctcaacagacctctcactctgtcagagaagatcgtgtatggtcacctggacaatccagca
gggcaggagatcgaccgtggacgcacctatctgcgtctgcgtccggaccgcgtggctatg
caggatgctacagctcagatggcaatgcttcagttcatcagcagcggcctccctagggtg
gcggttccttccaccatccattgcgatcacctgattgaagctcagattggagggactcag
gacctgcagaaggctaaggaggtgaaccaggaagtgtacaattttcttgcaactgctgct
gccaaatatggagttggcttctggaagccaggctcagggatcatccatcagatcatcctg
gagaattatgcctatcctggagtcctgttgattggtacagactcccacactcctaacggc
ggcggcctgggtggcatctgtattggagtgggtggagctgatgctgtggatgtcatggct
ggaatcccatgggagctcaaatgtcccaacgtgattggagtgagactgacaggcaccctg
tctggttggacctctccgaaggacgtcatcctgaaggtggcgggcatcctgactgtgaag
ggcggcactggagccattgtggagtatcatggtcctggagttgactccatctcctgcacc
ggaatggccactatctgtaacatgggtgctgagatcggagccaccacatccgttttcccc
tacaaccaccgcatgaggacgtacctggagaaaactggccgtggagagattgcctctgtg
gctaatcagtttaaggatgacttggtcccagataagggctgtgagtacgaccaggtcatt
gagattaacctgagcgagctgaagccccacatcaacggtccattcacccctgacctggcc
cacctcgtgtctgagattggggccattgctaagaagagcggctggcccctggaggttaaa
gtcggtctgattggcagctgcaccaactcgagctacgaggacatgggcagagcagcttct
ctggccaaacaggctctgaataaaggtttgaagtgcaaggcccagttcacagtgacccct
ggttctgaacagattcgtgccactattgagagggatggatattccaagaccctgagcgat
gttggtggagtcatgctcgccaatgcctgtggaccctgtatcggacaatgggacaggaag
gacgtaaagaaaggagaaaagaatactatcgtcacatccttcaacaggaacttcacagcc
aggaatgacgccaacccggctactcatgctttcgtcacctctcctgagattgtcaccgcc
ttggcccttgccgggaccctcgacttcaaccctgagactgactacctgaccgctcctaat
ggagagaagttcaagctagaaccccccaccggtgatgagctcccatccagagacttcgac
ccaggccaggacacctaccagcatcccccggccgagggcagctcagtccaggtggatgtg
aatccgtccagcaaccgtctgcagctcctggagccgtttgacaagtggcatggaaaagac
ctggaagacatgagggtcctcatcaaggtgaagggaaagtgtacaactgaccatatcagt
gccgccgggccctggctgaaattccgtggtcacctggacaatatctccaacaacctactg
atcggtgcagtcaacattgagaacgatgccgtgaacaaggtgaagaaccagctgacagga
gaatacgaaggtgtgcctgatgtggcacgccactacaaggccagtggggtgaactgggtg
gtggttggagacgagaactacggggaagggtccagcagagagcacgctgccctggagccg
cgacacctgggaggacgcgccattatcgtcaagagctttgctagaatccatgagactaat
ctgaagaagcagggcctgctgcctctgacttttgctgacccccgcgactatgaaagaatt
cgccctgatgacaagatttcaatcacaggcctgaagtccttcgctcctggcaagcccctg
acagcagtgatcaggcacagtgatggcagtcaggagaccatctctctaaaccacaccttc
aatgagacacagatcgagtggttcaaggctggctccgccctcaacaggatgaaggagctc
cagtaa

KEGG   Monopterus albus (swamp eel): 109957264Help
Entry
109957264         CDS       T05607                                 

Gene name
aco1
Definition
(RefSeq) cytoplasmic aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00020  Citrate cycle (TCA cycle)
malb00630  Glyoxylate and dicarboxylate metabolism
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb01210  2-Oxocarboxylic acid metabolism
malb01230  Biosynthesis of amino acids
Module
malb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109957264 (aco1)
   00630 Glyoxylate and dicarboxylate metabolism
    109957264 (aco1)
Enzymes [BR:malb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     109957264 (aco1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 109957264
NCBI-ProteinID: XP_020450657
Position
Unknown
AA seq 894 aa AA seqDB search
MSVTVKNPFQHIVESLDPKNPKQQFFNLSKLGDPRYDHLPFSIRVLLESAVRNCDEFLVK
RSDVENILNWKQTQSQTVEVPFRPARVILQDFTGVPAVVDFAAMRDAVMKLGGDPEKINP
VCPADLVIDHSIQVDFNRKSDSLQKNQDLEFDRNKERFQFLKWGSKAFKNMRIIPPGSGI
VHQVNLEYLAQVVFNHDGFFYPDSLVGTDSHTTMIDGLGVLGWGVGGIEAEAVMLGQPIS
MVLPEVVGYKLSGTPEKLITSTDIVLTVTKHLRQVGVVGKFVEFFGPGVAQLSIADRATI
ANMCPEYGATAAFFPVDDISIQYLEQTGREAEKLAYIKKYLKAVAMFRDYTDVSQDPNFT
QVVELDLSSVVPCCSGPKRPHDKIPVSDMKKDFETCLGAKQGFKGFQVAPEHHSTTVPFQ
FNGKDYILNHGSVVIAAITSCTNTSNPSVMLGAGLLAKKARECGLSVKPYIKTSLSPGSG
VVTYYLKESGVMDYLSQLGFEVVGYGCMTCIGNSGPLPEPVVEAITQGDLVTAGVLSGNR
NFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPIAINSEGKEIFLRDIWPTREEI
QAVERMFVIPSMFKEVYEKIEKVNERWNTLVAPSDKLYTWDPKSTYIKSPPFFNGLTMKL
QPPKSIHNAYVLLNLGDSVTTDHISPAGNIARNSPAARYLTNRGLTTRDYNSYGSRRGND
AVMARGTFANIRLFNKFLNKQAPQTIHLPTGETVDVFDAAERYQQSGDPLLVLAGKEYGS
GSSRDWAAKGPFLLGIKAILAESYERIHRSNLVGMGVIPLEYLPGDTADSLGLTGRERYT
IIIPEQLAPRMIISVKLDTGKTFQVRMRFDTEVELAYFRHGGILNYMIRKMSEN
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgactgtgaagaatccatttcaacatatagtcgagtctctggaccccaagaac
ccaaagcagcagtttttcaatctttccaaacttggtgaccccagatatgaccatctgccg
ttctccatccgggtcctcctggagtctgctgtcaggaactgtgatgagtttctggtgaag
cgctcagatgtagaaaatatcctcaactggaagcagacccagagtcaaactgtggaggta
ccgtttagaccagcccgtgtcatccttcaggacttcactggtgtccctgctgtggttgac
ttcgctgccatgcgtgatgcagtgatgaaactaggcggtgacccagagaagataaatcca
gtttgtcctgctgaccttgtcatcgatcattccattcaagtggatttcaacaggaagtct
gatagccttcagaaaaaccaggatttggagtttgaccgcaacaaagagagatttcagttc
ttgaaatggggttctaaagccttcaagaacatgcgaatcattcctcctggttcaggaatt
gttcaccaagtcaacctggagtacctggcccaagtggtgtttaaccacgatgggttcttc
taccccgacagcctggtgggcaccgactcccacaccaccatgatcgatggcctgggtgtc
cttggctggggtgtgggtggaattgaagctgaggctgtgatgctgggccagccgataagc
atggtgctgcctgaggtggtgggatacaagctgagcgggaccccagagaagctcattacc
tccactgacattgtcctaactgtcactaagcacctccgccaggtgggggtggtggggaaa
tttgtggagttttttggcccaggggtggctcagctatccatcgctgaccgagccaccatc
gcaaacatgtgtccagagtatggagccacagcagctttcttccctgtggacgacatcagc
attcaatatcttgagcaaaccggacgagaagcagaaaagctggcctacattaaaaagtac
ctgaaggctgtggccatgttcagagactacactgatgtctctcaggatccaaactttact
caggttgtggagctggatctgagttcagtggttccatgctgcagtggtcccaaaagaccc
catgacaagattcctgtttctgacatgaaaaaggattttgaaacctgcctgggagcaaag
caaggtttcaagggtttccaagtggcccctgagcatcacagcactacagtccccttccag
ttcaatggaaaggactatatattaaaccacggctccgtggtcattgctgctatcacgagc
tgcaccaacaccagcaacccatctgtcatgcttggagccggactcctggctaaaaaggca
agagagtgtggcttgagtgtgaagccgtacataaagaccagcctgtcacctggcagtgga
gtggtcacctactacctgaaggagagtggtgttatggactacctctctcagctgggcttt
gaggttgttggctatggttgcatgacgtgtattggcaacagtgggccgctccctgagccg
gtggtggaggccataacccagggagacctggttaccgcaggtgtcctgtcagggaacaga
aactttgaagggcgagtccaccccaacaccagagctaactacctggcttctccaccgctg
gtcatcgcgtacgctatagcaggcacagtgaggatcgactttgagaaagaacccattgcc
attaactctgaaggcaaagagattttcctaagggacatctggcccacacgagaggagatc
caggctgtggagagaatgtttgtcattccctcaatgttcaaagaagtttatgagaagatt
gagaaagtgaatgaacgctggaacactctggttgctccctctgacaagctgtatacctgg
gaccccaagtcaacctacatcaagtcaccgccgttcttcaatggcttgaccatgaagctg
cagcctcctaagtccatacataatgcctacgtgctgctgaacttgggagactcagtcacc
acagaccatatttctcctgcagggaacattgccaggaacagccctgcagcacgctacctg
accaacagaggtttgaccactcgtgactacaactcttatggctctcgtcgaggtaatgat
gctgtaatggccagagggacgtttgccaacatccgtctctttaacaagttcctcaacaag
caggcaccacaaaccattcacctgccaactggagaaacggtggatgtgtttgatgctgca
gagaggtaccagcagtctggtgaccctctgctggttctagcagggaaggagtacggctca
gggagctccagagactgggcagcgaaaggacctttcctgctgggtattaaggcaattcta
gcagagagttatgagcggatccaccgcagtaacctggttgggatgggagtgattcctctg
gagtatctaccaggagacactgctgacagtctggggctgaccggccgagaacgctacacc
atcatcatccccgagcagctcgcacccaggatgatcatcagtgttaaacttgacaccgga
aaaacattccaagtgcggatgagatttgacacagaggtggaactggcatatttccgccac
ggaggcatcctcaattacatgatccgcaagatgtctgaaaactaa

KEGG   Monopterus albus (swamp eel): 109971836Help
Entry
109971836         CDS       T05607                                 

Definition
(RefSeq) aconitate hydratase, mitochondrial-like
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00020  Citrate cycle (TCA cycle)
malb00630  Glyoxylate and dicarboxylate metabolism
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb01210  2-Oxocarboxylic acid metabolism
malb01230  Biosynthesis of amino acids
Module
malb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
malb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109971836
   00630 Glyoxylate and dicarboxylate metabolism
    109971836
Enzymes [BR:malb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     109971836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 109971836
NCBI-ProteinID: XP_020475999
Position
Unknown
AA seq 780 aa AA seqDB search
MATYCLTVARLQLALGRGARRLHVSAAYRAKAQVAMSRFEPASFINYEKLQSNVDIVRKR
LNRPLTLSEKIVYGHLDNPHSQEIVRGHTYLRLNPDRVAMQDATAQMAMLQFISSGLPKV
AVPSTIHCDHLIEAQIGGAKDLARAKEVNKEVYNFLSSAGAKYGVGFWKPGSGIIHQIIL
ENYAYPGVMLIGTDSHTPNGGGLGAICIGVGGADAVDVMAGIPWELKCPKVIGVRLTGSL
SGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVASISCTGMATICNMGAEIGATTSVFP
YNHRMRTYLEKTGRGQIAALADEYSDLLVPDEGCKYDQIIELNLDELKPHINGPFTPDLA
HPVSKIGAVAEKNGWPLEVKVGLIGSCTNSSYEDMGRAASVAKQALDKGLKCKAQFTVTP
GSEQIRATIERDGYSKILADVGGVVLANACGPCIGQWDRRDVKKGEKNTIVTSFNRNFTA
RNDANPATHAFVTSPEIVTALAIAGTLNFNPETDYLTAPNGEKFTLEPPSGDELPARDFD
PGQDTYQHPPADGTSLKVDVSPQSNRLQLLEPFDKWSGNDLEDMQVLIKVKGKCTTDHIS
AAGPWLKFRGHLDNISNNMLIGAVNSENDAVNKIKNCLTGEYGGVPDVARHYKANCVSWV
VVGDDNYGEGSSREHAALQPRHLGGRAIIVKSFARIHETNLKKQGLLPLTFSNPSDYDRI
CPDDKISIRGLKTFTPGKPLTAVVKHSDGSEETLELNHSFNKTQIEWFRAGSALNRMKEL
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtactgtcttactgtcgcccggctgcagctggccctgggccgtggtgcacgg
cgtctgcatgtatcagcagcttacagagcaaaggctcaagtggccatgagccgctttgag
cccgcttctttcatcaactacgaaaagctccagtccaacgtcgacattgtacgtaaaaga
ctcaaccggcccctcaccttgtcagagaagattgtttatggccacctcgataacccccac
agccaagagatcgttcgtggtcacacctacctgcgactgaatcccgaccgcgtggctatg
caggatgccacagcccagatggcgatgctccagttcattagcagcggcctgccaaaggtg
gctgtgccctccaccatccactgtgaccacctgattgaggcccagattggaggagcaaag
gatctggccagggcaaaggaagtcaacaaagaggtctacaacttcctgtccagtgctggg
gcaaaatatggagttggcttctggaaaccaggttctggaatcatccatcagatcatccta
gagaactatgcctatccaggagtgatgctcattggtacagattcccacacccctaatggt
ggaggacttggtgccatctgcattggagttggaggagctgatgctgtagatgtcatggca
ggaatcccctgggagctcaagtgtcccaaggtgattggcgtcaggctgacaggaagtctc
tctggctggacgtctcctaaggatgtcatcttgaaggtggccggcatcctgacggtgaag
ggaggtacaggagccatcgtggagtaccacggaccaggagtcgcctccatctcatgcact
ggaatggccaccatttgcaacatgggagcagagattggagccacaacctctgtgttccct
tacaaccaccgcatgaggacctacctggagaagactggacgtgggcagattgctgccttg
gctgatgaatactcagacctgctggtaccagatgaaggctgcaagtacgaccagatcatc
gaactcaatctggacgagctgaagccccatatcaacggaccgttcaccccggacctggct
cacccagtgtctaaaataggtgctgtggctgaaaagaacggctggccgctggaggttaaa
gttggtctgatcggcagctgtacaaactccagctacgaggacatgggccgcgctgcctct
gtggccaagcaggctttggataaaggccttaagtgtaaggctcagttcacagtcacgccc
ggctctgagcagattcgtgccaccattgagagagatggatattcaaagatccttgctgat
gttggaggcgtggttctggcaaacgcatgtgggccctgcatcgggcagtgggacaggcgt
gatgtgaagaaaggggagaagaacacaatcgtcacttccttcaacagaaacttcactgcc
aggaatgatgccaaccctgcaacacatgccttcgtcacctcccccgagattgtcactgcc
cttgccatcgctggcacattaaacttcaacccagagacagactaccttacagctcctaat
ggtgagaagttcacgctagagccgcccagcggagatgaactccctgcaagggactttgac
ccaggtcaggacacctaccagcatccacccgctgatggtaccagccttaaggtggacgtc
agccctcagagtaaccggctacagctgctggagccctttgataaatggagtggaaatgat
ctggaggacatgcaggtcctcatcaaggtgaagggcaaatgcactacagaccacatcagc
gctgctggaccttggctgaagtttcgcggtcacctggacaatatctccaacaatatgctg
atcggtgcagtcaacagtgagaacgatgcagtcaacaagatcaaaaactgcctgacagga
gagtacggaggagtccccgatgtggcccggcactacaaggccaactgtgtgtcatgggtt
gtggtcggagatgacaactacggtgaaggctccagcagagagcatgcagcgctgcaaccc
agacacctgggaggacgagccatcattgtcaagagctttgctagaatccacgaaactaac
ctgaagaagcagggtctgctcccactgaccttcagcaacccatcagactatgacaggatc
tgccctgatgacaaaatctccatcagaggcctcaaaaccttcactccagggaagcctctg
accgcagtcgttaagcacagcgatggcagtgaggagaccctggagctcaaccacagcttc
aacaagacacagatcgaatggttccgggcaggctctgccctcaacaggatgaaggagctg
tag

DBGET integrated database retrieval system