KEGG   Monopterus albus (swamp eel): 109953455Help
Entry
109953455         CDS       T05607                                 

Definition
(RefSeq) fructose-bisphosphate aldolase A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00010  Glycolysis / Gluconeogenesis
malb00030  Pentose phosphate pathway
malb00051  Fructose and mannose metabolism
malb01100  Metabolic pathways
malb01200  Carbon metabolism
malb01230  Biosynthesis of amino acids
Module
malb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
malb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109953455
   00030 Pentose phosphate pathway
    109953455
   00051 Fructose and mannose metabolism
    109953455
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109953455
   03036 Chromosome and associated proteins [BR:malb03036]
    109953455
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109953455
Enzymes [BR:malb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     109953455
Membrane trafficking [BR:malb04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    109953455
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109953455
Exosome [BR:malb04147]
 Exosomal proteins
  Proteins found in most exosomes
   109953455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 109953455
NCBI-ProteinID: XP_020444600
Position
Unknown
AA seq 363 aa AA seqDB search
MPHAYPFLTPEQKKELSDIAHKIVATGKGILAADESTGSVAKRFQSINAENTEENRRLYR
QLLFTADDRIVPCIGGVILFHETMYQKADNGKTFPQYLKERGMVVGIKVDKGVVPLAGTN
GETTTQGLDGLYERCAQYKKDGADFAKWRCVLKITPTTPSRLAIIENANVLARYASICQM
HGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTAGHSC
SHKYSNQEVAMATVTALRRTVPPAVPGITFLSGGQSEEEATVNLNAMNQCPLHRPWALTF
SYGRALQASALKAWAGKKENGKACQEEFVKRALANSLACQGKYVSSGASAAGGESLFVAN
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacgcataccccttcctcactcctgagcagaagaaggagctcagtgatattgct
cacaagattgtcgctaccggcaagggaatccttgccgcagatgagtccaccgggagtgtg
gccaagcgcttccagagcatcaatgctgagaacactgaggagaacaggaggctgtaccgc
caactcctcttcaccgctgatgaccgcatcgtcccttgcattggtggtgtaatcctcttc
catgagaccatgtatcagaaggccgacaatggcaagaccttcccccagtacctcaaagaa
agaggcatggttgttggtatcaaggttgacaaaggtgttgtccctctggccggaaccaat
ggcgagacaaccacccagggtcttgatggactgtatgagcgctgcgcccagtacaagaag
gatggtgctgactttgcgaagtggcgctgtgtgctgaagatcacccccaccactccctca
aggctggcgatcatagagaatgccaatgtccttgcccgctatgccagcatctgccagatg
cacggcatcgtccccatcgtcgagcctgagattctccctgatggtgaccacgatctgaag
cgctgccagtacgttactgagaaggtcctggctgctgtctacaaggctttgtccgaccat
cacgtctacctggagggcaccctgctcaagcccaacatggttaccgccggacactcctgc
tcacacaagtacagcaaccaggaggtcgccatggcaactgttactgccctgcgccgcact
gtgccccctgcagtccctggcattaccttcctatctggtggccagagtgaggaggaagcc
accgtcaacctgaacgccatgaatcagtgccctctgcacaggccttgggccctgaccttt
tcatatggacgtgccctgcaggcctctgccctgaaagcctgggctggcaagaaggagaac
ggaaaggcgtgccaggaggagttcgtcaagagagctctggctaacagcctggcctgccag
ggcaaatacgtttcctctggagccagcgctgctggtggagagtcactgttcgtggccaac
cacgcttattaa

DBGET integrated database retrieval system