KEGG   Monopterus albus (swamp eel): 109954119Help
Entry
109954119         CDS       T05607                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    109954119
Enzymes [BR:malb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     109954119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 109954119
NCBI-ProteinID: XP_020445181
Position
Unknown
AA seq 184 aa AA seqDB search
SKPTGLDFLLAFNVGIEIQGRLMRFSNEARNIPKRFHPPSVVGTMGSAAACAHLLSLDPS
RCSHALAIAASLSGAPMANAATQSKPLHIGNAARLGLEAALLASRGLEASPLVLDAVEGV
AGFSAFYEDYVPQPLESPSDGDHMFLLEKQDMGFKRFPAHLGMHWVADAAASVHKLLVGA
GPGT
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
agtaaacctactggcctggacttcctgctggcattcaatgtcggcattgaaatacagggc
cgattgatgaggttctccaatgaggcccgcaacatccccaagaggtttcaccctcccagt
gtggtagggaccatgggaagtgcagctgcctgtgctcacctcttgtccctggacccctcc
cgttgcagtcatgccttggccatagcagcttctttatctggagctccaatggctaatgct
gctactcagtctaaaccactccacattggtaatgctgcacgtctggggctggaggctgct
ctgctggcctcccgaggcctagaggcaagtcctctggtcttggatgctgttgaaggggtg
gctggtttcagtgctttttatgaagactatgtgcctcagcctttagaatcacccagtgat
ggtgaccatatgttcctgctagagaagcaggatatgggcttcaagcgtttcccagcccat
ctgggtatgcactgggtggcagatgctgcagcttcagttcataagcttctcgtgggagct
gggcctggcact

DBGET integrated database retrieval system