KEGG   Monopterus albus (swamp eel): 109954553Help
Entry
109954553         CDS       T05607                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109954553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:malb04030]
    109954553
G protein-coupled receptors [BR:malb04030]
 Rhodopsin family
  Lipid
   Leukotriene
    109954553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 109954553
NCBI-ProteinID: XP_020445612
Position
Unknown
AA seq 359 aa AA seqDB search
MNHSAEQSSLEEMAPEKFDGTMACVILGLSFLVGAPGNLLVIWTILRHVKQRSHTVVLIL
HLAAADLVVLITLPLWIYSLAYSWVFGEACCKAMVYVINACMYSSVFLITVMSVERFMAV
RYPFDSVNWRRKKALNKVLLALWTAAFLFSIPVIPTQVVGDDYGADHCLYRSYTSVTQEL
VCVLLETLVGYILPFSILVVCYSCLCSRIAQMTFKSKRKSTVLIASVVVVFAICWTPHHI
GNVLSLVNLAIENSFPETAHSLENVRSTMAFIAGAMGFISSSVNPILYMFAARSFRSSLS
DTGIQKLFRHISSTAPGEGNREVSFVSKRCNNQTSSSQCVLESKDQIDILIQMCENNPS
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaccactcagctgagcagtcttctttggaggaaatggcccctgagaagttcgatggg
acaatggcttgcgtgatcctgggcctgtccttcctggtgggagctccggggaacctgctg
gtgatctggactattctgagacatgtcaagcagcgttcccacactgtggtgctgatcctg
cacctggcggctgcagacctagtggtccttatcactctgcctctgtggatctactctctg
gcctactcctgggtgtttggagaggcctgctgcaaagccatggtgtacgtgatcaacgcc
tgcatgtacagcagtgttttcctcatcaccgtcatgagcgtggagcgttttatggctgtg
cgctatccctttgactcggttaactggaggagaaagaaagctctgaataaagtcctgctg
gccctgtggactgcagcattcctgttcagcatccctgtcatcccaacacaggttgttggg
gacgattatggtgcggaccactgtctgtaccggtcctacacttctgtaacccaggagctg
gtgtgtgtgttgctggagacactagtgggctacatattacccttctccatcctggtggtc
tgctacagctgcctttgtagcaggattgcacagatgaccttcaagtccaaacgcaagtct
actgtccttatcgccagtgtagtggttgtgtttgccatttgctggacacctcaccacatt
gggaatgtcctgtcactcgtcaacctggccattgaaaactccttccctgaaacagcacat
agtttggaaaatgtccgcagcaccatggccttcattgctggagccatgggcttcatcagc
agcagtgttaaccccatcctttacatgtttgcagctcgctccttcaggagctccctgagt
gacacgggtatccagaagctcttccgccacatctccagcactgccccaggtgagggcaac
agggaggtgtcctttgtgtccaagaggtgcaacaatcagaccagcagctctcagtgtgtg
ttggagtcaaaggaccaaatagatatattaatacaaatgtgtgaaaataacccatcctga

DBGET integrated database retrieval system