KEGG   Monopterus albus (swamp eel): 109954821
Entry
109954821         CDS       T05607                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:malb01002]
    109954821 (adamts13)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     109954821 (adamts13)
Peptidases and inhibitors [BR:malb01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   109954821 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_4 Reprolysin_3 TSP1_CCN TSP1_spondin Reprolysin_5 Reprolysin_2 ADAM_spacer1 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 109954821
NCBI-ProteinID: XP_020446079
Position
Unknown
AA seq 1443 aa
MVFTSLLCLLLLRPVFNTLMRSPLEGLFQHFSSERDIAPSPDASVNGQLHRSAKLPDITH
LELLVVVGPDVQQVHKQDTERYILTNLNIASELLRDITLGANMRVHLVRMVILSEPEPEI
QLSTNITSSLRSVCDWGRRINPSNDTDPLHADLLLYITRYDLVLPDGNKQVRGVAQLGGA
CSSEWSCVITEDTGFDLGITIAHEIGHSFGINHDGVQNTCSRSGFMMASDGGYNSVDLTW
SPCSRQQLLTFFSEAKAECVKDLPAMEGSLQDWKPGLYYGVDDQCRIAFGSTARACSFTN
PDLPLCRVLSCHIKPDDNSSCKRLLVPLLDGTECAPNQWCLKGRCVSPDELSSSVVVHGS
WSSWSEFSLCSRTCGGGVTHRTRQCNNPRPSFGGNDCEGLDIKAELCHQQPCEHTQMDFM
AEQCSQTDLHPLYLQPHTPSFYTWIPAVGFTQGDEQCRYICQTDGENFIVSRGSQFVDGT
RCESDTVTPFGATAACLKGKCQLFGCDGVLHSGKLKDVCGVCGGDGSSCSLNSDSYTGGQ
TRVSACYSIISVSEYTTFLSLPVNATQVHIVNRAPLFTHMAVMVGDQYIVSGMGSMALNM
THPSPLDDNGLEYRLHLTPDLLPEMEELLLPGPLQEEIHIQVYRRYGKEYGEKTNPNISY
EFYVPTRNRDMTDTPKGNWVVFTTPCSVSCGSGKLPLVTKHTEKYIKKNCLLLCFLSFPY
KFKDCLFFLYILCHIAGIQKHVYVCVDEDTNNHLEEHNCETAPPAIPLHTTCQLSPCPPR
WDTGKFGPCSASCGGGERVRPVTCVQKHGAIVVKVPSSECPPDTAPNVVEKCNLQHCPAR
WRISEPAKCSAVCGPGEAKQTVLCVRPENGQDVEVDQSFCSKQTRPPDSVPCVVDVCPIG
WESKGEDQPQLKSGLLPNTRQAPVYVWSPVISQCSKTCGNGTLQVWFSCVDHQTRLGVPD
FHCDASTKPSFQSETCNTSPCSPVWRSKQGVCSVTCGGGVANRVLYCAQETEGEEEVVED
SECSGFPKPAVVVSCNTHSCPAKWKVLRTSPCSVSCDLGVAQRLVSCVQYVHGKESMVPE
ENCRTTVKPATTVPCLAQVCTFRWEVTPWSQCSVPCEYGIQSRAVSCMGPSKPEPLSPLF
CMHIPKPITIQGCYMGGCMHTSDATTNTTTVAHTEVKANLTEEGPVLSPSMGQKDRPHLH
KSRLSPSLTQTLTIPQSTTTVNPTPKPSTCGQLLLEESGVVDLKDITGRCTVSIGRPLDE
VIHIKVESSSLNCRKKEYVAFFDRLAFIRKCDLAASSELTTRTNVLLVRQNLLTPGNGVV
LTYSSQKNMKKSHHQDCDIQLFSPRGVFENPTTPNTNHTCRVLINAPPLVKIRIQALHIG
FNSTNTQSTYITIRDMDVLKTNVFKGHQLFLWHSSGNMAEIEFHGDYMHSNGSFRAEYSF
MRP
NT seq 4332 nt   +upstreamnt  +downstreamnt
atggtttttacgtctctgctctgtctgctgttgctgcgacctgtcttcaacactctaatg
agatctccattggaagggctttttcaacacttctctagtgaaagagatatcgctccctct
cctgatgcctctgtaaatggacagctgcatcgatcagctaaattgcctgatatcacacat
ctggaattgctggtagtcgtaggacctgatgtccagcaggtccacaagcaggacacagaa
agatacatcctcaccaacctcaatattgcctcagagctgttgagagacataaccctgggt
gccaacatgcgggtgcacctggtccgcatggtcatcctgtcagagccagagccagagatc
cagctgtctaccaacatcacctcttctcttagaagtgtgtgtgactggggcagaaggatc
aacccctccaatgacacagacccattacatgctgatctcctgttgtacattacaaggtac
gacctggtgttgcctgatggaaacaagcaggtgaggggagtagcacagctgggtggggct
tgctccagtgaatggagctgtgtaattactgaggacacaggctttgacctggggatcacc
attgctcatgaaattggccatagttttggaatcaaccatgatggagtgcaaaacacttgc
agcaggagtgggttcatgatggcctctgatgggggctacaacagtgtggatctgacctgg
tccccctgcagcagacagcagctgctcacattcttcagtgaagcgaaagctgaatgtgta
aaagacctgcctgcgatggaaggctccctgcaagactggaagcctggtctgtactatgga
gttgatgaccagtgtcgaatagcttttggtagcaccgctagagcctgttctttcaccaat
cctgatctgcccctttgtcgtgttctgtcctgtcacattaaacctgatgataacagctcc
tgcaaacgtctcctagttccactgctggatgggacagagtgtgcacctaatcagtggtgt
ctgaaggggcgttgtgtgtccccagatgagctcagttcctctgttgtggtgcatggctcc
tggtccagttggtctgagttctccctctgctcacgaacatgtggtgggggcgtcactcac
cgcacccggcaatgcaacaatcccagaccttcttttggagggaatgactgtgagggtctg
gatatcaaagctgaactttgtcaccagcagccatgtgagcacacccagatggattttatg
gcagagcagtgttcccaaacagaccttcacccgctctacttacaaccacacactccttct
ttctacacatggatccctgctgtaggcttcacacaaggagatgaacagtgcagatatata
tgccagacagatggagaaaacttcatagtgagccgtggctctcagttcgtggatggcact
cgctgtgagtcagacactgtgactccctttggtgctacagctgcctgtctaaaaggaaaa
tgccagctgtttggctgtgatggtgtgctgcattctgggaaactgaaggatgtgtgtgga
gtgtgtggtggagacggatcgtcctgcagtttgaactctgactcctacactggtggccag
accagagtgtctgcttgttattcaatcatttctgtttcagagtacaccaccttcctctct
ctgccagtgaatgctacacaagttcatattgtcaacagggcacctctcttcactcatatg
gctgtaatggttggggatcagtacattgtgtccgggatgggcagtatggcactgaatatg
actcacccctccccactggatgataacggccttgagtaccggctccacctgacccctgac
ctcttgccagagatggaggagctgctactgcctggaccactgcaagaggagatacacata
caggtctatcgcagatatggaaaagaatatggagagaaaacaaatcctaacattagttac
gagttctatgtacctaccagaaacagagatatgacagacacacctaaaggcaactgggtc
gtctttacaacaccctgctctgtctcctgtggatcaggtaagttaccgttagtcacaaaa
cacactgaaaagtatataaaaaaaaactgcttactgttatgtttcctatccttcccttat
aaattcaaagactgtttgttctttttatacatattatgtcatattgcaggtatacagaag
catgtatatgtgtgtgtagatgaagacactaacaaccatttggaggaacacaactgtgaa
acagctcctccagccataccactgcacacaacctgtcagctctccccctgtccccccagg
tgggacactgggaaatttgggccttgtagtgcatcctgtggcggaggagagagagtgcgc
cctgtaacatgcgttcagaaacatggagccatcgtggtaaaagttcctagttctgaatgc
ccacctgatacagctccaaacgttgttgaaaaatgcaacctacaacactgtcctgcaagg
tggcgtatatcagagccagctaaatgttcagcagtgtgtggaccaggagaagcaaagcaa
accgtgttgtgtgtccggccagaaaatggacaggacgttgaagtggatcagagcttctgt
tcaaagcaaacacgaccacctgattcagtgccctgtgtggtagatgtctgccccattgga
tgggaatctaagggagaggaccaaccccagctaaagtctggtttgttgccaaacactaga
caagctcctgtgtatgtgtggagccctgttatcagccagtgctcaaaaacctgtggcaat
ggaaccctgcaggtgtggttttcctgtgtggaccaccagacgagactgggggtgcccgac
ttccactgtgatgcttctaccaaaccctctttccaatctgagacctgcaacacatctccc
tgctctcctgtgtggcgctctaagcaaggagtctgcagtgtaacttgtggaggaggggtg
gccaacagggtgctgtactgtgctcaagaaacagaaggggaggaggaggtggtagaggat
tcagagtgcagtggctttcctaagcccgctgtagtggtgtcatgtaacactcacagctgc
ccagcaaagtggaaggttctgagaacatcaccctgctctgtgtcctgtgatttgggtgtg
gctcagagacttgtgtcttgtgtccagtatgtccatggcaaagagagcatggtcccagag
gaaaactgccgcacaactgtgaaaccagccaccacagtgccctgcctggcccaagtctgc
accttcaggtgggaggtgacaccatggagccagtgttcagtaccctgtgaatatgggatc
cagtccagagctgtgtcctgcatgggcccctctaagccagagcccctcagcccactgttt
tgtatgcacatacccaaacctatcaccatccagggctgctacatgggcggctgcatgcac
acatcagatgccaccactaacaccactactgtagcgcatactgaagtgaaagctaacctc
acagaggagggacctgtcctgtctcccagtatgggtcaaaaagataggccacatctccac
aagagccgtctttctccaagtctaacacagacgctaaccatcccacagagcaccacaaca
gtgaacccaacacctaaacccagtacatgtggacagctactacttgaagaatcaggcgtg
gtggatttgaaagacataactggccgctgcacagtatccataggacgacctctggatgag
gtcattcacattaaagtggaatctagctccttaaactgcagaaagaaggagtatgtggca
ttttttgatcgactggcattcataaggaagtgtgatttggcagcaagtagtgaactgacc
acaagaaccaacgtcctgctggtgcgacaaaacctgctcacccctgggaatggggtcgtt
ctcacctacagttcacagaaaaatatgaagaagagccaccatcaggattgtgacattcag
ctcttttccccccgcggtgtgtttgaaaatccaactacacccaacaccaaccacacctgt
cgcgtgcttatcaacgcccctcccctggtgaagatcagaatccaggccctacacatagga
ttcaacagcaccaatacccagtctacatacattacgatccgggacatggatgtcttaaag
accaacgtttttaaaggccatcagctgtttttgtggcattcctctggaaatatggctgag
attgaatttcatggagactacatgcattccaacgggagcttcagagccgaatattccttt
atgcgtccatga

DBGET integrated database retrieval system