KEGG   Monopterus albus (swamp eel): 109955657Help
Entry
109955657         CDS       T05607                                 

Gene name
cdk15
Definition
(RefSeq) cyclin-dependent kinase 15 isoform X1
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109955657 (cdk15)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     109955657 (cdk15)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: CMGC group
  CDK family
   109955657 (cdk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 109955657
NCBI-ProteinID: XP_020447696
Position
Unknown
AA seq 455 aa AA seqDB search
MEDLSRWVREARCWMRRCCCGEEEEDEEKKGKREEGDEEVEMEDLSCRKSRSSTWPPPAE
QDPDGSALPLSGSQPYWFHTLQVRRLPVQRGRSNSDPLRGPSNKDQFPWEPGLQFGAAQS
YVSLEKLGEGAYSSVYKSISRINGQLVALKVIHMKTEEGVPFTAIREASLLKRLKHANIV
LLHDIIHTRESLTFVLEYVQTDLAQYMTQHPGGLHSHNVRIFMFQLLRGLGYIHSRRILH
RDLKPQNLLISHLGELKLADFGLARSKSIPSQTFSSEVMTLWYRPPDILLGSTDYSTAVD
MWGAGCIFIEMLQGAPAFPGVSDVFEQLQKIWAVLGVPTEDGWPGVSLLPNYKPEWFVQS
KPKQFKTIWKRLNQLPYKTEDLVQRMLKGVPTHRISAQDALQHPYFSTLPPSIMHLRDTV
SIFKVPGIYLETEVRDMFHPGRKLQLSLLHAAKNW
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggaggatttgtcccggtgggtgagggaggctaggtgctggatgaggaggtgctgttgt
ggtgaggaagaggaggatgaggagaagaaagggaagagagaagaaggagatgaggaggtg
gagatggaggatctcagctgcagaaaaagcaggagctcaacttggcccccacctgctgag
caggatccagatgggtctgccttgcctctctccgggtctcagccttattggttccataca
ctgcaggtccggcggctgccggttcagagaggacgcagcaacagcgatccactgagaggc
ccgagcaacaaggaccagttcccctgggaaccagggctgcagttcggagccgctcagtcg
tacgtgagcctggagaaactgggagaaggcgcgtactcatccgtgtacaaaagcatcagc
aggataaacgggcagctggtggctctgaaggtgatccatatgaagacagaggagggcgtc
ccattcacggccatcagagaagcatctctgctcaaacgtctgaaacacgccaacatcgtc
ctcctccatgatatcatccacaccagagagtcgctcacctttgtcttagaatatgtgcag
acagacctggcccagtacatgacccagcaccccggaggtctgcactcacacaacgtgcgg
atcttcatgttccagctgctgcgaggcctcggctacatccacagccggagaatcctccac
cgagacctgaagcctcagaacctgctcatcagccacctgggagaactcaaactggccgac
tttggtctggcgcggtccaagtccatccccagtcagaccttctcctcagaggtgatgact
ctgtggtaccggccccctgacatcctgctggggtccacagattactccaccgccgtggac
atgtggggagctgggtgtatcttcatcgagatgctgcagggggcgccagcattccctgga
gtctctgatgtgtttgaacagctccagaagatctgggcggtcctgggtgtgccaactgag
gatggctggcctggagtcagtctgctacccaattataaaccagagtggtttgttcaatct
aagccaaaacagtttaaaaccatttggaaaaggttgaaccagctgccctacaagaccgag
gacctggtccaaagaatgctgaagggggtccccacacaccggatctcagctcaggatgct
ctgcagcacccatacttcagcacgctgcctccttccatcatgcacctcagagacacagtg
tcaatcttcaaggttcctggtatctatctggagacagaagtcagagacatgttccacccc
ggtaggaagctccaactctccctgctgcatgctgcaaaaaactggtag

DBGET integrated database retrieval system