KEGG   Monopterus albus (swamp eel): 109955857Help
Entry
109955857         CDS       T05607                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00232  Caffeine metabolism
malb00983  Drug metabolism - other enzymes
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    109955857
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109955857
Enzymes [BR:malb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     109955857
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 109955857
NCBI-ProteinID: XP_020448071
Position
Unknown
AA seq 291 aa AA seqDB search
MMNLEEYFQRIGFDGSHDKPDLATLKLIHKKHILSIPFENLSIHCGERITQDLEVIFNKI
VRSGRGGWCLENNSLFGWVLRQMGYDTVTLSSRVFQSTINEFGLDDTHLINKVVIDGKAY
ITDVSFGVSSQMREPLELVSGMDQPQAAGVFCLIDKGDMWVLEKTGRKPEVINPEFAESS
LVSRKVTKQIYCFTMVPREADHFFEANHKLQTDPTSLFTCKSICSLQTPTGFRALIGCTY
SEVTYKPEEGVDVLDMKDIPDDEMEPLLRERFSLTLQNKLQPVNKKAWYTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatttggaggagtacttccaaagaattgggtttgatggctctcatgacaaacct
gatctggcaacactgaagctgatccacaaaaagcacatcctgtcaattccatttgaaaac
ctcagcattcactgtggggaaaggattacccaggacctcgaggtaattttcaataagata
gtgaggagcggtcgtggaggttggtgccttgagaacaactccctgtttggctgggtgctc
agacaaatgggctatgacactgtgaccttgagctctagagttttccagagtaccatcaat
gaatttggccttgatgacactcacctcatcaacaaggtggtcattgatggaaaggcttat
ataacagatgtaagctttggagtgtcttcccaaatgcgggagcccctggagctcgtctct
ggaatggaccaacctcaggcagcaggggtcttttgtcttattgacaaaggggacatgtgg
gtgctggagaagactggaagaaagccagaggtcatcaatccagaatttgctgaatcaagt
ctggtcagcagaaaagtaacgaaacagatctattgcttcaccatggtgcctcgtgaggct
gatcatttctttgaggcaaaccacaaacttcagacagatcctacttcactatttacctgt
aaatctatctgctccttgcaaacacccacaggattccgagccctgattggctgtacctac
agtgaggtcacctacaagccagaggaaggagtcgatgtcttagatatgaaggacatacca
gatgatgagatggaaccacttctgagggagaggttcagtttaacactgcagaacaaactg
cagcctgtaaacaaaaaagcatggtacacactctga

DBGET integrated database retrieval system