KEGG   Monopterus albus (swamp eel): 109956057
Entry
109956057         CDS       T05607                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04080  Neuroactive ligand-receptor interaction
malb04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109956057 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109956057 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 109956057
NCBI-ProteinID: XP_020448523
Position
Unknown
AA seq 77 aa
MNVKILTLVIVLLVSLLCSASAGPMASTEHGKEVEEATTVRKMVQQNPTRGGQTHRPAGW
KRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttctgcc
agtgctggtcccatggcctccacggagcatggcaaagaagtggaagaggcaactacggtg
agaaaaatggtccagcaaaaccctacaaggggcggtcagacccacagaccagccggctgg
aagaggagacgcccacggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system