KEGG   Monopterus albus (swamp eel): 109956077Help
Entry
109956077         CDS       T05607                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00450  Selenocompound metabolism
malb00970  Aminoacyl-tRNA biosynthesis
malb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    109956077 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109956077 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:malb01007]
    109956077 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:malb03016]
    109956077 (mars2)
Enzymes [BR:malb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     109956077 (mars2)
Amino acid related enzymes [BR:malb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   109956077 (mars2)
Transfer RNA biogenesis [BR:malb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    109956077 (mars2)
 Prokaryotic type
   Other AARSs
    109956077 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 109956077
NCBI-ProteinID: XP_020448584
Position
Unknown
AA seq 601 aa AA seqDB search
MRFPFLFISRRWNVKAVHRPQQSPCISSILALTRDQRFFVLRYTSTSLFKNDRNHYITTP
IFYVNASPHLGHLYSAVIADCLHRYKLLQGFDSKFATGTDEHGLKIQQAAEAAGKDPLTF
CTDVSERFKHLFSSCNIAYTDYIRTTEQRHHRAVEHFWSVLWNKGLIYKGSYEGWYSTQD
ESFLMPSQVDNAVDSSGKDIKVSLESGHKVEWMKEENYMFRLCAFRSQLLDWLRGNPRAV
QPERFYQTVLQWLQEDLPDLSVSRQRSRLHWGIPVPGDSEQTIYVWLDALVNYLTVAGYP
NKYDQWWSRAHHIVGKDILKFHAIYWPAFLLGAGLPLPQTIYVHSHWTVGGKKMSKSLGN
VVDPLECSQIFTTDGMRYFLLRQGVPDSDCDYTDEKVIKLLNAELADSLGGLLNRCTAPA
LNPAQVYPSFCPQSFPSKQGGRTVVEDYHMLDAVKNLPATVEQHYERMHVYKALEAITAC
VRQTNKFVQRHTPWKLDRRDSKDQRWLDTIIHVSFECLRIYGTLLQPVVPEISNKLLSRL
GVQPGERNWAALKFLLRYQGMDCPFEGRALGSDSGVLFSRVERQNVDKERKKTTKKVAKL
K
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttccttttctttttatcagcagaaggtggaacgttaaggctgttcacagaccg
caacaaagtccatgtatatcatcaattttagctctgactagagaccagaggttcttcgtg
ttgagatacaccagcaccagtctgttcaaaaacgacaggaatcactacataaccactccc
atcttctatgttaatgcttcacctcatttaggacacttgtattcagctgtgatagctgac
tgcttacacaggtataaactgctccagggattcgactcaaagtttgcaacaggcacagat
gaacatggcttgaaaatccagcaagctgctgaagcagcaggaaaagatcccctgactttc
tgcacggatgtgtctgagagattcaaacatctcttcagcagctgcaacatagcgtacaca
gactacataagaaccactgagcagagacaccaccgagccgtggagcatttctggtcagtg
ctctggaacaaagggctcatctacaaggggagttatgagggctggtactccacacaagat
gaaagcttcctcatgccttcgcaggtggacaatgctgtggactcatcagggaaggatatc
aaagtgtcgctggagagtgggcacaaggtggagtggatgaaagaggagaactacatgttt
cgtctgtgtgcgttccggtctcagctgctcgactggctcagaggaaatcccagggctgtg
cagccggagcgtttctaccagactgttctccagtggctgcaggaggaccttcctgacctc
tcagtgtcccggcagaggagccgtcttcactggggcatcccagtccctggtgattctgag
caaaccatctatgtgtggctagatgccctggtgaactacctcacagtagctggctaccca
aataaatatgaccagtggtggagcagggcccaccacattgtaggaaaggacatcttaaag
ttccatgccatctactggccagcttttctactaggagctggactgccactgccacagaca
atatatgtgcactctcactggactgtgggggggaagaagatgtctaaaagtctgggtaat
gtagtagatcctctcgagtgttcacagattttcacaactgatggtatgaggtacttcctt
ttgcgtcagggtgtcccagactcagactgtgactacacagatgagaaggttatcaagctg
ctcaacgcagagcttgctgactctctgggtggtctgcttaatcgctgcacagctccagct
cttaacccagctcaggtctatccttctttctgtcctcagtccttcccaagcaaacaggga
ggacgtacagtggttgaagactaccacatgttggatgctgttaaaaatctccctgctaca
gtggagcagcactatgagcgcatgcacgtgtacaaagctctggaggccattactgcctgt
gtgaggcagaccaacaagtttgttcagcgccacacaccatggaagctggacaggagggac
agcaaagaccaacgctggctagacaccatcatccatgtctcctttgaatgcctgaggatt
tatggcacacttctccagccagtagtgccagagatttctaacaagctcctgtccagactc
ggggtgcaaccaggtgagaggaactgggcagcgctaaagttcctgctaaggtatcaggga
atggactgtccatttgaagggagagcactagggtctgactctggagtactgtttagtcgt
gtggaaagacagaatgtagataaagaaaggaaaaagacaacaaaaaaggtagcaaaattg
aaatga

DBGET integrated database retrieval system