KEGG   Monopterus albus (swamp eel): 109956510Help
Entry
109956510         CDS       T05607                                 

Gene name
dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:malb04131]
    109956510 (dock8)
Membrane trafficking [BR:malb04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109956510 (dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109956510
NCBI-ProteinID: XP_020449325
Position
Unknown
AA seq 2090 aa AA seqDB search
MASLGSAERRAFALKLNRHSSAEIRRHFGGNYDIHHSRTSSSSSTSVCLNVPQSYEAVEP
LDLEEFLMSQLRSGESALMQELGDFPDDDLKVEQVEKECRTVRHSVPEDGVELGPHVRDC
VKTYTQPWLVVSRRCQGDGWSAYSTRAGLHKCLQKQTFDSDVQPENQEKPVKSPTLARLT
DESGRTLTSSDFNLRCLTPDQRVEGLLAFSSHEELDRFNQEARQGNRYPELFALYPPADE
EDAVEIRPIPDCPKEHTGDRILVRCQAIKFEIDIEPIFATMALFDLKEKKKISENFYCDL
NSDQFKNFLKPHTPHVNNSALAKSAIFSITYPSPDIYLVIKIEKVLQQGEISDCVEPYMT
LRECDSAKNKDKLEKLRGQAEAFCQRLGRYRMPFAWATVKIMDVISTAAIDHDITDSDSL
KGGKSSSIDRRAQLPRRNSERYSGIDDQFCNISAFKRATVTISPIFKQEGERLSDEDLLK
ILAEIKKTSNPQRRIKAIPGFIKLDMSPVHTTPQGCLSTELIPLLPVPEKTVLPVKEVLE
FPSSEVYVPHNIYRNLLYVYPQRLNLVNRLTSARNITIKIQFMCGEDPSCSLPVIFGKSS
GPEFLQEVYTPVTYHNKSPDFYEEVKLALPAHLTERHHLLFTFYHISCQQKQNQSGNCET
LIGYSWLPMLNNDRLQTGQFCLPIILDRLPVNYSLHPPEKLPLQVPPVKWMEGHKGLFNL
EIQAVSSVHTQDNHLERFFTLCHALEGGATFPLRVRDEKIPENKLEHELKLSIISLPSSS
LEPLVLFLHLVLDKLFTLIMQPMVIAGQTANLAQIAFESVVSIVNSLHNSQELIRDQQGR
NSLLATYLYWVFRLPDPPQDMQNAGGIPSAESRYSTMGRATAATVGSMLLQSKIRSSSNP
DIPGPHTSDEDAEVKNILSAKGLNNPGSRMSTYVDVNNHQNPTGSTRPSNRKHFHEELAL
QMVVSTGVCRENAYKYAWFFFELLVKSMAQHVSQLDKYGVPRRSRFSDRFKDDISTIVSV
VTAEIGTILVKQPKELEQAEKVNISLAFFLYDLLSLMDRGFVFQLVKNYCNQMSAKSVSM
PTLISMRLEFLQILCSHEHYLNLSLFFSSAASAPTSPCPSISSQSSGSCSFQEQQRILGL
FELSQEFKQQHYLTGLVLTELSAALDMESEGGKVQRKAINAIHSLLCSHDLDQRCVKPEV
RAKVAALYLPLVGIIIDSTNYLDFTVSDARSGKNKTGGLEDDLEIVPPINQSVAMAIAGN
PFNTLGRNVLVSMASLQGKSIATLAADTSRHLLVCFLWVMKNADKSLIQRWTVDMPPSQL
NKLLELLTICVSCFEYRGKQSSDKVSTQALQKSQHAKLQLEEALLRGMGARGEMMKRVGG
TDRTMGQRENLRWRKDLTQWRQTNDKQDKTKAELDQEALISGNLATEANLIVLDLLETIV
QALPLADCKDSVVGGVLKVILHSLTCNQSTTFLSHTFSTLRALIVKFGDLLFEEEAEQCA
DLCQKVLQYCSSPVDENRSQACATLYLIMRYSYSNASNFSRVKMQVTMSLASLVGKSSDF
QEEYLRRSLRTILAYAEEDTEMQNTPLPSQVDELLRNLNSILSDTVKMREFQEDPEMLMD
LMYRIAKGYQTSPDLRLTWLQNMAEKHNNKKCYTESAMCLVHAAALVAEYLSMLEDHKYL
PVGSVTFQNISPNVLEESAVSDDILSPDEDGVCSGRYFTESGLVGLLEQAAELFSNGGLY
EAVNEVYKIIIPILEAHRDFRKLASTHDKLQRAFENIIQKGHKRMFGTYFRVGFYGAKFG
DLDEREFIYKEPGITHLPEISHRLENFYSQCFGDDTLIMIKDSTPVDRKQLNPKKAYIQI
TFVEPYFDDYEMKDRLTNFEKNYNLRRFMYTTPFTKSGRPRGELHEQYKRKTILTTMHAF
PYVKTRLNVIQKEEFDLTPIEVAIEDMQKKTRELAVATHREQPDAKMLQMLLQGSVGATV
NQGPLEVAQVFLNEIPADPKLFRHHNKLRLCFKEFIMRCGEAVEKNKHLIMLDQKEYQEL
KKNYNRLKESLRPMLERKIPELYKPIIRPRLENRDSFKRLSLRRTQEENS
NT seq 6273 nt NT seq  +upstreamnt  +downstreamnt
atggcttctctgggaagcgcagagcgacgggcttttgcactgaaactcaacaggcattct
tctgcagagatcagacgacactttggtgggaactatgacattcatcacagccgaacaagt
tccagttcttcgacctcagtgtgcctcaatgtgccccagtcgtatgaagcggtggagccc
ctggacctggaggaattcttgatgtcacagctacgaagtggagaatcagccctgatgcaa
gaacttggagacttccccgatgatgacctgaaggtggagcaggtggagaaggagtgtcgc
actgttcgacactctgtccctgaagatggagtggagcttggtccccatgtaagagactgt
gtaaagacttacacccagccgtggcttgtggtttcaagaaggtgccagggggatggttgg
agcgcctattcaactcgagctggcctgcacaagtgtcttcagaaacagacctttgactct
gatgttcagccagaaaaccaagagaaaccagtcaagtctccaactttagcaaggctcacc
gatgaatctggtcgcacgctgacctcctctgactttaacctgcgttgtttaactccagac
cagagggtagaggggctgttggctttcagcagccatgaggagttggaccgcttcaaccag
gaggcacggcaggggaatagataccctgagctgtttgctctgtatccaccagctgacgag
gaagatgccgtggagatccggcccatccctgactgccccaaggagcacactggagaccgc
atcctggtccgatgccaggccatcaagtttgagattgacattgagcccatatttgcaact
atggctctgtttgatctgaaagagaagaaaaagatatcggagaacttctactgtgacctg
aattcagaccagtttaaaaacttcttgaaacctcacacgccacatgtgaataattctgct
ttggctaaatccgccatattctcaatcacctacccttccccagatatctacctggtcatc
aagattgaaaaggttctccagcagggtgagatcagtgactgtgtcgagccctatatgaca
ctgagggaatgtgactctgcaaagaacaaggacaagcttgagaagctgcgaggccaggcg
gaggctttctgccagaggctgggtcggtatcgcatgccttttgcctgggcaacagttaaa
atcatggacgtcatctctactgctgcgatagaccacgatatcacagactctgacagctta
aaaggaggtaaatccagcagcattgaccggagagcacagcttcccaggaggaactctgaa
cgttatagtgggattgatgatcaattttgtaacatttctgccttcaaacgtgctaccgtc
accatcagccccatcttcaaacaggagggagagcgcctgagtgatgaggacttgctgaag
atcctggctgagatcaagaaaacctccaatccacagaggagaatcaaggcgataccaggg
ttcataaaactggacatgtccccagtccacaccacaccacagggatgtttgtccactgag
ctcatccctctcctaccagtacctgagaaaactgtgttgccagtcaaagaggtgctggag
ttcccatccagtgaggtttatgtccctcacaatatttacaggaacctgctctatgtttac
ccccagaggctcaacttagtcaacagactgacttcagcaagaaatatcaccatcaaaatc
cagtttatgtgcggagaggaccctagttgctcgctgcctgtcatttttggaaaatcaagt
ggccctgaatttttgcaggaagtttatacccctgttacctaccacaacaagtccccagac
ttctatgaggaagtgaagctggctctcccagcccatctgacagagagacatcacttgctc
ttcaccttctaccacatcagctgccagcagaaacagaaccaaagcggcaactgtgagaca
ctcatcggatactcttggctgccaatgctgaataatgaccgactgcagactggccagttc
tgtctgcctattattttggacaggctgcctgtcaactattcactgcacccacccgagaaa
cttcctcttcaggttcctccagttaagtggatggagggtcacaaaggacttttcaacctc
gagattcaggctgtgtcatctgtacacacacaggacaaccacctggagcgtttcttcacc
ctctgccatgccctggagggtggagctacattccctctacgggtcagggatgagaagatt
ccagagaacaagctggagcatgagctaaagctcagtatcatctccctgccctcctccagt
ttagagcctttggtcctctttctccacctggtgctggataaacttttcaccctcatcatg
cagccaatggtcatcgctggccagaccgccaatctggcccagatagccttcgaatcagtg
gtgtctattgtcaacagtcttcataacagccaagagctgatcagggaccagcagggcagg
aacagcctcttagcgacctacctttactgggtgttccgtctgccggatcctcctcaagac
atgcagaatgcaggtggtatcccttcagcagagagccgttacagcaccatgggtcgggcc
acagcagccacagttggcagtatgctccttcagtccaaaatccgcagcagcagcaacccc
gatattcccggtccacacacctctgatgaagatgctgaggtcaaaaacatcctctctgcc
aagggtctcaacaacccaggcagtcgcatgtccacttatgtggatgtaaacaaccaccag
aaccccacaggaagcaccaggccctctaacagaaagcactttcatgaggagctggcccta
cagatggttgtcagtaccggggtctgcagagagaacgcatacaaatatgcctggttcttc
tttgagctgctggtgaaaagtatggctcagcatgtgtctcagctggacaagtatggtgtc
cctagaagaagtcgcttctctgacagatttaaagatgacatcagtaccattgtttctgtg
gttacagctgagattggcactatccttgtcaaacaaccaaaggagttagagcaagcagag
aaagtcaacatcagcctggccttcttcctctatgacctgctgtcactcatggaccgagga
tttgtctttcagctggtgaagaactactgtaaccagatgtcagctaaaagtgtttcaatg
ccaaccctgatcagcatgcgtctggagttcctgcagattttgtgcagtcatgagcactac
ctcaacctgagcctctttttcagcagcgctgcctctgcccccacctcaccatgtccttcc
atctcctcacagagttccggttcatgtagtttccaggagcagcagaggatcttagggctg
tttgagctttctcaggaattcaagcagcagcactacctcaccggtctggtgcttacagaa
ctcagtgctgccctggacatggagtcagaggggggaaaggtccagagaaaggccatcaat
gccatccacagcctgttgtgttcccatgaccttgaccaacgctgtgttaaacctgaggtc
agagccaaggtggccgctctctacctccccctggtggggattatcattgactccaccaac
tatctggacttcactgtttctgacgcacgcagtgggaaaaacaagacgggcggactagaa
gatgaccttgaaattgtcccacccatcaatcagtctgttgccatggcgattgccgggaac
cccttcaacacactgggacgaaatgttctcgtttccatggcgtccttgcaaggtaaatcc
atagccaccctggcagcagataccagtcgccacctgttggtgtgtttcctgtgggtgatg
aagaatgctgataagagtctgattcagcgctggactgtagatatgcctccttcgcagctc
aacaagctgctggagctcctaactatctgtgtctcctgctttgagtacaggggtaagcag
agcagtgacaaagtgagcacacaggccttacagaaatctcagcacgccaagctgcagctg
gaagaagccctgctgagaggaatgggtgcccgcggggaaatgatgaaacgagttggaggt
acggatcggaccatgggccagagagagaacttgcgctggaggaaagatctgactcagtgg
agacagaccaatgacaaacaggacaagactaaagcagagttggaccaggaggctctgatc
agtgggaacttggctacagaagcaaacctaattgtgctggacctgctggagaccatcgtc
caggcactgcctctggctgactgtaaggacagtgtggttggtggggtgttgaaggtgata
ctccactctctcacctgcaaccagagtaccacttttctctctcacacgttcagcacactc
agagcgcttattgtcaagtttggagacctgttgtttgaggaggaggcagagcagtgtgca
gacctgtgccagaaggtgcttcagtactgcagcagtcctgtagatgagaacaggagccag
gcctgtgccaccctctacctgatcatgagatacagctacagtaatgccagtaacttctca
agagtgaagatgcaggtcaccatgtctctagcctcattggtgggcaagtcatcagacttc
caagaggaatacttacgacgctcgctgcgcaccatcctggcctatgcagaggaggacact
gagatgcagaacaccccgctgccctcacaggtggatgagctcctgagaaaccttaacagt
attttgtcagacacagtaaaaatgagggagttccaggaagatcctgagatgcttatggac
ctcatgtacaggatagcgaagggctaccagacatctcctgacctccgtctgacctggctg
cagaatatggcagagaaacacaacaacaagaagtgttacactgagtcggctatgtgtctg
gtccacgctgctgccctggtggccgagtacctcagcatgttggaggatcacaagtacctg
cctgttggcagtgtcaccttccagaacatttcgcccaacgtgctggaggagtcggcggtg
tctgatgacatcctgtccccagatgaggatggtgtgtgttcgggacgctacttcaccgag
agcggcctggtggggttgctggaacaggctgctgagctcttcagcaatggtggtctctat
gaggcagtgaatgaagtctacaagatcatcataccgatcctagaagctcatagagatttc
agaaaactggcatccactcacgacaaactacagagagcctttgagaacatcattcagaag
ggccataagaggatgtttggaacctatttccgggtgggtttttatggggccaaatttggt
gacctagacgaacgggaattcatttacaaggagcctgggatcacacatctgcctgagata
tcacacaggctggagaacttttacagtcagtgttttggagacgacacattgattatgatc
aaggactctacaccagtggacaggaaacagctcaacccaaaaaaggcatatatccagatc
acttttgtggagccctactttgatgactatgagatgaaagacaggctgacaaactttgag
aagaactacaacctgcggcggttcatgtacaccacgcccttcaccaagagcggacggcca
cggggtgaactccacgagcagtacaagaggaagaccatcctcaccaccatgcatgccttc
ccctacgtcaagactcgcctcaatgtcatccagaaagaggagtttgatctaactcctatt
gaggtggccatagaggacatgcagaagaagactagagagctagcagttgctacacacaga
gaacagcctgatgctaagatgttacagatgctgctacaaggctctgtgggggccactgtt
aatcagggtccattggaggtggcccaggtcttcctgaatgagatcccagcggacccgaag
ctcttccgtcaccacaacaaattgcgcctgtgtttcaaggagtttataatgaggtgtggt
gaggcagttgagaagaataagcacctgatcatgttggaccagaaggagtatcaggaactg
aagaagaactacaaccgcctgaaagagagcctgaggcctatgctggagagaaagatccct
gaactatataaaccgatcatcaggcctcggctggagaacagggactctttcaaacgtcta
agtttgcgcagaactcaggaggaaaactcctga

DBGET integrated database retrieval system