KEGG   Monopterus albus (swamp eel): 109957493Help
Entry
109957493         CDS       T05607                                 

Gene name
mtmr7
Definition
(RefSeq) myotubularin-related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00562  Inositol phosphate metabolism
malb01100  Metabolic pathways
malb04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109957493 (mtmr7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109957493 (mtmr7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:malb01009]
    109957493 (mtmr7)
Enzymes [BR:malb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     109957493 (mtmr7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     109957493 (mtmr7)
Protein phosphatases and associated proteins [BR:malb01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    109957493 (mtmr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related DSPc Y_phosphatase DUF1043 Y_phosphatase3 GRAM
Motif
Other DBs
NCBI-GeneID: 109957493
NCBI-ProteinID: XP_020451056
Position
Unknown
AA seq 663 aa AA seqDB search
MVKYLDVENVRLLDRVFPRKRRVGTLYLTATHTIFVENEAGVRNETWVLHSLVCSVEKQA
AAASGCPLLIHCKNFQVLHFVIPGERECHDVHLSLQRLSQPGGFAHQTLAVLCLAESYME
LYCFSYKPNVDEENRRQEWDFLDLQADYSRMGLPNSLWKLSPINQHYKVSDTYPADLFVP
ESAMPPVIVGSSKFRSRGRFPTLSYYYKENHAAICRSSQPLSGFSARCLEDEQMLQAILR
SNPSSDFMYVVDTRPKLNAIANRAAGKGYENEDNYSNIKFRFIGIENIHVMRNSQQKMLE
VCEPRSPSMSNFLEGLESSGWLKHIKAVLDAGNFIAKAVAEEGVSMLVHCSDGWDRTAQV
CSVACVLLDPYYRTLRGLMVLIEKEWVSFGHKFSHRCNHLVGDPKEASPIIDQFLECVWQ
LMEQFPCAFEFSERFLITIHSHIYSCQYGNFIGNNQRERIELGVREKTHSLWSYLWMNRA
DYINPLYRPDHSQTRGLLQLSTAPYCFKFWSGLYNHFDRGIHPRQSAEDCLRAIQEETQQ
LEEQLASHKQKIAQLEHEQEWSVTQKSTTFDKSPTAWTLNNGLNLANTPQDYTGGSITSS
PCQLKVLDSSLLLLPQDLNQTSDSNLSNGSDQESGIADLSCRSPLSEDSIRDPDSDEAVY
IAA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaatatttggacgtggagaacgtcaggctgctcgacagagtgtttcccagaaag
aggagggtgggcaccctctacctgacggccacacacaccatctttgtagagaatgaggct
ggtgtgcgaaatgaaacatgggtgcttcacagtttggtgtgcagtgtggagaaacaagct
gctgcagcctccggatgtcctctgctcattcactgtaagaacttccaggttcttcatttt
gtcattcctggagagcgagaatgccacgacgttcacctgtccctgcagcgtctctcccag
ccaggaggttttgctcatcagactttagcagtgttgtgccttgcagagagttacatggag
ctgtattgcttctcatataagcctaacgttgatgaggagaacagacggcaggagtgggac
ttcttggacctccaggctgattacagccgaatgggactcccaaactctctgtggaaactt
tcccccatcaaccaacactacaaggtgagtgacacttaccctgctgacctgttcgtacct
gagtcagccatgcctccagttatagtagggagctccaagttcagaagcagaggcagattc
cctactctttcgtactactacaaagaaaatcatgccgccatctgccgtagcagccagccc
ctgtcaggtttcagcgctcgctgcctggaggatgaacagatgctgcaggccatcttgagg
tccaatcccagcagtgacttcatgtatgtggtggacaccaggcctaagctgaatgcgatc
gcaaaccgagctgcaggaaaaggctacgaaaatgaagacaactactccaacattaagttc
cggttcatcggcatagagaacatccatgttatgagaaatagccaacaaaaaatgctggaa
gtgtgtgagccacggtccccctccatgtctaacttcctggagggtctggagagctcaggc
tggctgaagcacatcaaagctgttttggatgcaggcaacttcattgccaaggctgttgca
gaagagggtgtcagtatgctggttcactgctcagatggttgggaccgtactgcccaggtg
tgctcagtggcctgtgtgctgctggatccctactacaggaccctcagaggactcatggtt
ctcattgagaaagagtgggtctcatttggacacaagttctctcacagatgcaaccacctg
gttggagaccctaaagaggcgtctcccatcatcgaccagttcctggagtgtgtgtggcag
ctgatggagcagttcccctgtgcctttgagttcagcgagaggttcctcatcaccattcac
agccacatctactcctgccagtatggcaacttcattggcaacaaccagcgggagaggata
gagctgggagtgcgcgagaagactcactctttgtggagttatctatggatgaaccgtgca
gactacatcaatcctctgtacaggccagaccacagccagactcgggggctcctccaactg
tctactgccccctactgttttaaattttggagcgggctgtacaaccactttgaccgaggg
atacatcctcgacagtctgcggaggactgcctgagggccatccaagaggagacgcagcag
ctggaggagcagctggcttcacacaaacagaaaattgctcagctagagcatgagcaggag
tggagtgtcactcagaaatcgaccacctttgataaaagccccacagcatggactctcaat
aatggcctcaatttggccaacacccctcaggactacaccggtggctccatcaccagcagc
ccctgtcagctaaaagtgttggacagcagcctgctcctcctgccgcaagacttgaaccaa
acctctgactccaacctctccaatggcagtgaccaggagtcggggatcgcagacctgagc
tgtcgttcccctctcagcgaggatagcatccgggatccagactcggatgaggctgtctac
attgctgcctga

DBGET integrated database retrieval system