KEGG   Monopterus albus (swamp eel): 109957542Help
Entry
109957542         CDS       T05607                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 1-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb00061  Fatty acid biosynthesis
malb00071  Fatty acid degradation
malb01100  Metabolic pathways
malb01212  Fatty acid metabolism
malb03320  PPAR signaling pathway
malb04146  Peroxisome
malb04216  Ferroptosis
malb04920  Adipocytokine signaling pathway
Module
malb_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:malb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    109957542
   00071 Fatty acid degradation
    109957542
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109957542
  09143 Cell growth and death
   04216 Ferroptosis
    109957542
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109957542
   03320 PPAR signaling pathway
    109957542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:malb01004]
    109957542
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:malb04147]
    109957542
Enzymes [BR:malb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     109957542
Lipid biosynthesis proteins [BR:malb01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   109957542
Exosome [BR:malb04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109957542
  Exosomal proteins of breast cancer cells
   109957542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C Lambda_Kil
Motif
Other DBs
NCBI-GeneID: 109957542
NCBI-ProteinID: XP_020451150
Position
Unknown
AA seq 698 aa AA seqDB search
MLSQEFFQKLGLSDLDDVSQYIRNVFTAMLVSMGAVTAATAYYLATRPRPHPPICDLRMQ
SVEVPGSDLVRRSALQAGDTHLTHFYDDARTIYEFFLRGLRVSNNGPCLGFRKPKQPYEW
MSYREVMEHAENLGSAFLHKGHSKITNPHVGIFSLNRPEWTISELACYMYSLVSVPLYNT
LGVQAIAYIIDKASIATIVCDAVDKVNLILECVKNRNHSVKTIILMETPSADLVNRGQQA
GIHILSLQEMEALGKASYHQPVPPRPEDMALICFTSGTTGDPKGVMLTHGNIVSNCSAFI
KVTAFSCPLGPSDVQISFLPLAHMFERVVQGVMMVHGAKIGYFQGDIRLLADDLNTLRPT
VFPVVPRLLNRMYDKIFGQANTSFKRWVLEFAYRRKERELMKGIMRRNSIWDWLIFRKVQ
GSLGGRVRLIITGAAPISPTVLTFLRAAIGCQFYEGYGQTECTAGCTLSLGGDWTAGHVG
APLPCNSIKLVDVPEMNYLAENREGEVCVKGSNVFQGYLKDPEKTAETIDADGWVHTGDI
GKWLPNGTLKLVDRKKHIFKLAQGEYIAPEKIENVYMRSNAVAQLFVHGDSLQACLVAVV
VPDPDFLSGWTKRTLGIQGSYEELCGRADVKAAILEDMLRLGKEGGLSSFEQVKAIYIHT
ELFSVENGLLTPTMKAKRNEIQQLFRPQIDELYAGLKI
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccaggagttctttcagaagctggggttgtcagatctggatgatgtcagtcaa
tacatcaggaatgtcttcaccgccatgttagtcagcatgggggcagtgacagctgcgacc
gcctactacttggcaacacggcccaggccccatccaccaatctgcgacctccgcatgcag
tcagtggaggttccaggcagcgacttggtgcgcagatctgctctgcaggccggagatact
cacttaacacatttctacgatgatgccagaacaatatacgagttcttcctcagagggctc
agagtctccaataatggtccctgtctgggcttcaggaaacctaagcagccctatgaatgg
atgtcctatagggaggtaatggagcatgcagagaatctgggttctgcatttcttcacaaa
ggacactccaagatcaccaacccgcacgtcggcatcttctctttgaacagacctgagtgg
accatcagtgagctggcatgttacatgtactctctggtgtcagtccctctgtacaacacg
ctgggagtgcaagccattgcctacattatagacaaagcttccatcgccaccatcgtgtgt
gatgcggtagacaaagtcaacttgatactggagtgtgttaaaaacaggaaccactcagtg
aaaaccatcattctaatggagacccccagtgctgacctggtcaacagggggcaacaggca
ggaatccacatcctcagcctgcaggagatggaggctctcgggaaggccagctatcaccaa
ccagtgcctccacgacctgaggacatggcactcatctgcttcaccagtggaacaacagga
gatccaaagggagtcatgttgacgcatgggaatattgtgtccaactgctcagccttcatc
aaagtgacagcgttttcctgtccattgggtcccagtgatgtccaaatttccttcctgccc
ttggctcacatgtttgagagagtagtacagggagtgatgatggtgcatggggccaaaatt
ggttatttccagggagatattcgtttgttggcagatgacctgaacacactgagaccgact
gtgtttcctgtggtgccccgactcctaaacagaatgtatgataagatctttgggcaggcc
aacacctctttcaaacgctgggtactggagtttgcctacaggagaaaggagagagagtta
atgaaaggcatcatgagaagaaacagtatctgggattggctcatcttcaggaaggtccag
ggtagccttggtggccgcgtgcgcctcataataacaggagctgctccgatctctcctact
gttctcaccttcctcagagctgcaattggctgtcagttctatgaaggctatggacaaaca
gagtgtactgctggatgcactttgagcctgggtggagattggactgcaggtcatgtagga
gctcctctgccctgtaactctattaaactggtggatgtgcctgagatgaactacctggct
gagaacagagagggcgaggtgtgtgtgaagggttcaaacgtgttccaaggctatctgaag
gacccagagaaaaccgcagagacgattgatgcagatggatgggttcacactggggacatt
ggaaaatggctgccgaatggcacgctgaagcttgtggacaggaagaagcacatcttcaag
ttggcacagggggagtacattgctcccgaaaagatagagaatgtctacatgaggagtaat
gcagtggcacagctctttgtgcatggagacagtctgcaggcgtgtctggtagcagtggtg
gtccctgaccctgacttcctgtctggctggaccaagaggacactgggaatccagggcagc
tacgaggaactatgtggcagagcggatgtcaaagcagccattttggaagatatgctgcga
ttgggcaaggaaggaggcctcagctcctttgagcaggtgaaggccatttacatccacacc
gagctattttcagtggaaaacggtctactcactccaacaatgaaggccaagaggaatgaa
atacaacagctcttcaggccccagatagacgagctctatgcagggctcaaaatatag

DBGET integrated database retrieval system