KEGG   Monopterus albus (swamp eel): 109957683Help
Entry
109957683         CDS       T05607                                 

Gene name
plk3
Definition
(RefSeq) serine/threonine-protein kinase PLK3
  KO
K08862  polo-like kinase 3 [EC:2.7.11.21]
Organism
malb  Monopterus albus (swamp eel)
Pathway
malb04068  FoxO signaling pathway
malb04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:malb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109957683 (plk3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109957683 (plk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:malb01001]
    109957683 (plk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:malb03036]
    109957683 (plk3)
   03400 DNA repair and recombination proteins [BR:malb03400]
    109957683 (plk3)
Enzymes [BR:malb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     109957683 (plk3)
Protein kinases [BR:malb01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   109957683 (plk3)
Chromosome and associated proteins [BR:malb03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Polo kinases
    109957683 (plk3)
DNA repair and recombination proteins [BR:malb03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    109957683 (plk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Kinase-like Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 109957683
NCBI-ProteinID: XP_020451431
Position
Unknown
AA seq 622 aa AA seqDB search
MTKPELGQVVTDSKTGKSYSKGKLLGKGGFARCYEMTDLSNNKMYAVKVIPQSRVSKPHQ
RDKITNEIELHKTLSHKHVVKFSHHFEDHENIYIFLELCSRKSLAHIWKARHTLTEPEVR
YYLRQIISGLKYLHSKGILHRDLKLGNFFVNENMELRLGDFGLAAKLETVEQSKKTICGT
PNYLAPEVLNRQGHGTESDVWSLGCVMYTLLCGNPPFETLDLKETYKCIKEVRYNLPSTL
SPAAQKLISGILQKNPSDRLTLDQILTHEFFTKGFTPDKLPPSSCVMVPELHPPSPAKKF
FTKMAKSLFGKKKTKVEKIPCEEKDDKDISKLVSGIVKCSINRQISCKTVGPNEVPSPTG
QLVSSVPLEQTPAEEESRKSISRSFKGTMASSTEPCEDVLTPAAVADSAMKVLNSCLANM
PAATRNPPCLSRPHSFLWVTKWVDYSNKYGFGYQLSNQTIGVLFNEGTHLSLCDQRKTVH
YCLTNNKHFTFPTSSLPEQLRSQKQIVELMANYMEQNLMEGGDLHCEDQVSAAPPLLLQW
VKTDHALVMLFNNGTLQVNFYTDHTKIILCKSSDDSYLLTYINRERVSYTYLLSMLNEMG
CTPELRHRLQYVVQLLQHHTGA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccagagctcggacaggttgtgaccgactccaagacaggaaaatcctacagt
aaagggaagcttctgggaaagggtggctttgctcgatgctatgagatgacagacctctcc
aacaacaaaatgtatgctgtgaaggtgattccacagagcagggtgtccaaaccacaccag
agggacaagattacgaatgagattgagctgcacaaaaccctgtcacacaagcatgtggtg
aaattctcccatcattttgaagaccatgaaaacatctacatattcctcgagctttgcagt
cggaagtccctggcacacatttggaaggcgagacacacacttacagagccagaagtgaga
tattaccttaggcagatcatatctggcctcaaatacctccacagcaaaggcatcctacac
agagatctcaagctaggtaacttctttgtcaatgagaacatggaactgcggctgggagac
ttcggccttgctgccaagctggagacagtcgaacagagtaaaaagacaatttgtgggact
cccaactacttggcccccgaggtgctcaacagacagggccatggcacagagtctgacgtt
tggtccctcggatgtgtcatgtacacacttctatgcggtaacccgccgtttgagactctt
gacctgaaggagacctacaagtgtataaaggaagttcggtacaatttgccctccacgctt
tcccctgctgcacagaaactcatttcaggcatcctgcagaaaaaccccagcgacagactg
acgctggatcaaattctcacccatgaattcttcaccaaaggtttcactccggataagctt
ccacccagcagttgtgtgatggtgccagagctccacccccccagccctgccaagaaattc
ttcactaaaatggcaaagagcctctttggcaagaaaaaaacaaaagtggaaaaaattcca
tgcgaggaaaaagacgacaaagacatttccaagctggtgtctggaatcgtaaaatgttcc
atcaaccggcagatcagttgcaagacagtgggacccaatgaggtgccctctcccaccggc
cagctggtcagctctgtgcctctggaacagactcctgctgaggaggaatccaggaagtcg
atctctcgttcgttcaagggcactatggccagcagcaccgaaccatgtgaagatgtcttg
acgcctgcagctgttgctgactcagccatgaaagttctcaacagctgcctggctaacatg
cctgcagccaccaggaacccgccctgtctgtccaggccacactccttcctgtgggtgact
aaatgggttgactactccaacaaatacggatttggctaccagctgtcgaaccaaactatt
ggtgtgctcttcaatgaaggaacacacctcagtctttgtgaccaacgcaagacagtccac
tactgcttgaccaacaacaaacacttcacttttcctaccagctctctacctgagcagctt
cgcagccagaaacaaattgtagagctaatggccaactacatggagcagaaccttatggag
ggtggagatctacactgtgaggatcaggtctcagctgcacctcctctgctgctccagtgg
gtgaagactgaccatgctcttgtcatgctcttcaacaatggcactctacaggttaacttc
tacacagaccacaccaagatcatcctgtgcaagtcatctgatgactcttacctgctcacc
tacattaaccgggaacgtgtctcatacacttacctcctcagcatgctgaatgagatgggc
tgcacccctgagctgcggcacagactccaatacgtggtccagctgctccaacaccacaca
ggtgcctga

DBGET integrated database retrieval system