KEGG   Monopterus albus (swamp eel): 109957846
Entry
109957846         CDS       T05607                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: acid-sensing ion channel 1-like
  KO
K04829  acid-sensing ion channel 1
Organism
malb  Monopterus albus (swamp eel)
Brite
KEGG Orthology (KO) [BR:malb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:malb04040]
    109957846
Ion channels [BR:malb04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   109957846
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 109957846
NCBI-ProteinID: XP_020451730
Position
Unknown
AA seq 550 aa
MPVRIMCTISFSSDDEPSGGYGKDMFDDHYRRVKKSYDDGDSQDYLHGCSQVDDYNDEED
DNSDVKDLATFFSGSSLHGTNHVFVENKKFGIRQGLWAVVFTMAVSAFLLQVADRVIYYL
QYDHITILDEKVANNLTFPAVTICNYNFIRKSQMSYSDLIFMSPLLGFEEGMAPGFPLAL
EPDRPPGSGFSMDEFFNRTRHRMEDMLLECEFRGDECGPENFTEIFTRYGKCYTFNSGKD
GRPLMVTMKGGMGNGXNLPVWGETDETSFEAGIKVQIHTQQEPPFIDQLGFGVAPGFQTF
VSCQEQRLIYLPPPWGDCKAKAMDSDFFSTYSITACRIDCETRYLVENCNCRMVHMPGDA
PYCTPEQYKDCADPALDFLVEKDSDYCVCDTPCNLTRYGKELSFVKIPSKASAKYLAKKF
NKTEQYIAENILVLDIYFEALNYETIEQTKAYEFAGLLGDIGGQMGLFIGASLLTILELF
DYLYEVIKYKLCQCFRKKHKGRTNKDRGAVLSLDDVKRHAPSENLRTPSTYPGNMLPHHP
GQGNFEDFTC
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgccggttcgaattatgtgcaccatctccttttcgtccgatgatgagcccagcggagga
tatggtaaagacatgtttgatgaccactaccgacgtgtaaagaagagttacgatgatggg
gactcacaagactacctgcatggctgtagtcaggtggatgattacaatgatgaggaagat
gataacagtgatgtgaaagacctggccactttcttcagtggttcttcacttcatggtacc
aaccatgtgtttgtggagaacaagaaatttggtattcgccagggcttgtgggcggtggtc
ttcacaatggctgtgtccgcctttctgctccaggtggctgacagagtcatatactatctc
cagtatgatcacattactatcctggatgaaaaagtggccaacaaccttactttcccagct
gtcaccatatgtaactacaactttatacgaaagtctcagatgagctacagcgatttgatt
ttcatgagccctctgttgggcttcgaagaaggcatggcaccggggttcccgctcgccctg
gagccagaccgcccaccaggctctggcttcagcatggacgaattcttcaatcgcactcga
caccgcatggaggacatgctactggaatgtgagttcagaggcgatgagtgcggccctgaa
aacttcacagagatattcacgcgctatggaaaatgctacacctttaattcaggaaaagat
ggacgacccctgatggttacaatgaagggtgggatgggcaacggcnncaacttgcctgtt
tggggagaaactgatgagacatcgtttgaagcagggatcaaagttcagatccacacccag
caggagccgccatttatagaccagctgggttttggagtggcgccggggtttcagaccttt
gtctcctgtcaggaacagcggctgatatacctgcctccaccatggggggactgcaaggct
aaggcaatggactcagacttcttcagcacttacagcatcacggcctgccggatcgactgt
gagacacgatacctggtagagaactgcaactgcaggatggtccacatgcctggtgatgcc
ccctactgcaccccggaacagtacaaggactgtgcagatcctgccttggactttcttgtt
gagaaagacagtgactattgtgtgtgcgacacaccatgcaacttgacacgctacggcaaa
gagctgtcctttgtcaagatacccagcaaagcatcagccaaataccttgccaagaaattc
aacaagacagagcagtacatagctgagaacattctggttctggatatctacttcgaagca
ctgaactacgaaacaattgaacaaacgaaagcctatgaattcgcagggcttttgggcgat
atcggaggccaaatgggccttttcattggagccagcctcctcaccatccttgaactcttt
gactatctatatgaggtgatcaagtacaagctgtgccaatgcttcaggaagaaacacaaa
ggccgcaccaacaaagaccggggagctgtgctgagcctggatgatgtgaaacgccatgct
ccttccgagaacctgcgtacaccatcaacataccctggcaacatgctacctcatcaccca
ggccagggtaactttgaagacttcacttgctga

DBGET integrated database retrieval system